| Primary information |
|---|
| PRRID | PRRID_1266 |
| Ligand Name | eosinophil-derived neurotoxin (EDN) |
| Source | NA |
| Sequence of ligand | MGPKLLESRLCLLLLLGLVLMLASCLGQTPSQWFAIQHINNNANLQCNVEMQRINRFRRTCKGLNTFLHTSFANAVGVCGNPSGLCSDNISRNCHNSSSRVRITVCNITSRRRTPYTQCRYQPRRSLEYYTVACNPRTPQDSPMYPVVPVHLDGTF |
| Length | 156 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | breakdown prod- ucts of extracellular matrix |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
| Domain | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
| Assay used | NA |
| PMID | 24754320 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1266 |
| Ligand Name | eosinophil-derived neurotoxin (EDN) |
| Source | NA |
| Sequence of ligand | MGPKLLESRLCLLLLLGLVLMLASCLGQTPSQWFAIQHINNNANLQCNVEMQRINRFRRTCKGLNTFLHTSFANAVGVCGNPSGLCSDNISRNCHNSSSRVRITVCNITSRRRTPYTQCRYQPRRSLEYYTVACNPRTPQDSPMYPVVPVHLDGTF |
| Length | 156 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | breakdown prod- ucts of extracellular matrix |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
| Domain | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
| Assay used | NA |
| PMID | 24754320 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |