Primary information |
---|
PRRID | PRRID_1158 |
Ligand Name | surfactant protein-A |
Source | Endogenous (others) |
Sequence of ligand | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Length | 248 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | triggers immune responses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
Assay used | NA |
PMID | 23985302 |
Year of Publication | 2013 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1158 |
Ligand Name | surfactant protein-A |
Source | Endogenous (others) |
Sequence of ligand | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Length | 248 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | triggers immune responses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
Assay used | NA |
PMID | 23985302 |
Year of Publication | 2013 |
Pubchem assay | Pubchem_assay |