| Primary information |
|---|
| PRRID | PRRID_1136 |
| Ligand Name | S100 proteins |
| Source | NA |
| Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Length | 92 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | NA |
| Name of receptor | RAGE |
| Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
| Source | Human |
| Localization | graft-versus-host disease (GVHD) |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | S100 proteins were significantly more detected in saliva of GVHD patients |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_1136 |
| Ligand Name | S100 proteins |
| Source | NA |
| Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Length | 92 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | NA |
| Name of receptor | RAGE |
| Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
| Source | Human |
| Localization | graft-versus-host disease (GVHD) |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | S100 proteins were significantly more detected in saliva of GVHD patients |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | NA |