Primary information |
---|
PRRID | PRRID_1136 |
Ligand Name | S100 proteins |
Source | NA |
Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Length | 92 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | NA |
Name of receptor | RAGE |
Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
Source | Human |
Localization | graft-versus-host disease (GVHD) |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | S100 proteins were significantly more detected in saliva of GVHD patients |
Assay used | NA |
PMID | 23985302 |
Year of Publication | 2013 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_1136 |
Ligand Name | S100 proteins |
Source | NA |
Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Length | 92 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | NA |
Name of receptor | RAGE |
Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
Source | Human |
Localization | graft-versus-host disease (GVHD) |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | S100 proteins were significantly more detected in saliva of GVHD patients |
Assay used | NA |
PMID | 23985302 |
Year of Publication | 2013 |
Pubchem assay | NA |