| Primary information |
|---|
| PRRID | PRRID_1129 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | elicit innate immune response |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages |
| Domain | Cell Surface (Exogenous) |
| Sequence of Receptor | Q6R5P0.fasta |
| Swiss prot ID | Q6R5P0 |
| Length Of Receptor | 926 |
| Function |  TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1129 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | elicit innate immune response |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages |
| Domain | Cell Surface (Exogenous) |
| Sequence of Receptor | Q6R5P0.fasta |
| Swiss prot ID | Q6R5P0 |
| Length Of Receptor | 926 |
| Function |  TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | Pubchem_assay |