Primary information |
---|
PRRID | PRRID_1054 |
Ligand Name | H protein |
Source | fimbriae of Escherichia coli (Bacteria) |
Sequence of ligand | MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ |
Length | 137 |
Type | Protein |
Occurence | Natural |
Role of Ligand | NA |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | human peripheral blood mononuclear cells (hPBMCs) |
Domain | NA |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | ELISA |
PMID | 24016850 |
Year of Publication | 2013 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1054 |
Ligand Name | H protein |
Source | fimbriae of Escherichia coli (Bacteria) |
Sequence of ligand | MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ |
Length | 137 |
Type | Protein |
Occurence | Natural |
Role of Ligand | NA |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | human peripheral blood mononuclear cells (hPBMCs) |
Domain | NA |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | ELISA |
PMID | 24016850 |
Year of Publication | 2013 |
Pubchem assay | Pubchem_assay |