Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0986 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0986 |
| Ligand Name | Cytochrome c |
| Source | NA |
| Sequence of ligand | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
| Length | 105 |
| Type | Small molecule |
| Occurence | Natural |
| Role of Ligand | Immunostimulant |
| Name of receptor | TnSR |
| Type of receptor | Scavenger receptor (SR) |
| Source | Tetraodon nigroviridis |
| Localization | NA |
| Domain | SR cysteine-rich domain, two coiled-coil collagenous domains, a transmmebrane domain, and a short N-terminal intracellular region with an unexpected TNFR-associated factor 2-binding consensus motif s |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | TNF-a inflammatory pathway. |
| Assay used | NA |
| PMID | 22988031 |
| Year of Publication | 2012 |
| Pubchem assay | NA |
| Primary information | |
|---|---|
| PRRID | PRRID_0986 |
| Ligand Name | Cytochrome c |
| Source | NA |
| Sequence of ligand | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
| Length | 105 |
| Type | Small molecule |
| Occurence | Natural |
| Role of Ligand | Immunostimulant |
| Name of receptor | TnSR |
| Type of receptor | Scavenger receptor (SR) |
| Source | Tetraodon nigroviridis |
| Localization | NA |
| Domain | SR cysteine-rich domain, two coiled-coil collagenous domains, a transmmebrane domain, and a short N-terminal intracellular region with an unexpected TNFR-associated factor 2-binding consensus motif s |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | TNF-a inflammatory pathway. |
| Assay used | NA |
| PMID | 22988031 |
| Year of Publication | 2012 |
| Pubchem assay | NA |