| Primary information |
|---|
| PRRID | PRRID_0956 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | NA |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. |
| Assay used | NA |
| PMID | 21955443 |
| Year of Publication | 2011 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0956 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | NA |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. |
| Assay used | NA |
| PMID | 21955443 |
| Year of Publication | 2011 |
| Pubchem assay | NA |