Primary information |
---|
PRRID | PRRID_0956 |
Ligand Name | profilin-like protein |
Source | T. gondii (others) |
Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
Length | 165 |
Type | Protein |
Occurence | Natural |
Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
Name of receptor | Toll-like receptor 10 (TLR10) |
Type of receptor | Toll-like receptor (TLR) |
Source | NA |
Localization | NA |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. |
Assay used | NA |
PMID | 21955443 |
Year of Publication | 2011 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_0956 |
Ligand Name | profilin-like protein |
Source | T. gondii (others) |
Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
Length | 165 |
Type | Protein |
Occurence | Natural |
Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
Name of receptor | Toll-like receptor 10 (TLR10) |
Type of receptor | Toll-like receptor (TLR) |
Source | NA |
Localization | NA |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. |
Assay used | NA |
PMID | 21955443 |
Year of Publication | 2011 |
Pubchem assay | NA |