| Primary information |
|---|
| PRRID | PRRID_0955 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induction of immune response against T. gondii |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Myeloid cells, uroepithelial cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | induces the release of interleukin 12 against T. gondii infected mice |
| Assay used | NA |
| PMID | 21982558 |
| Year of Publication | 2011 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0955 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induction of immune response against T. gondii |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Myeloid cells, uroepithelial cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | induces the release of interleukin 12 against T. gondii infected mice |
| Assay used | NA |
| PMID | 21982558 |
| Year of Publication | 2011 |
| Pubchem assay | NA |