| Primary information |
|---|
| PRRID | PRRID_0886 |
| Ligand Name | Fimbriae H protein (FimH) |
| Source | Uropathogenic E.coli (Bacteria) |
| Sequence of ligand | MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Length | 300 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | stimulate the innate immune system and elicits protective responses against bacterial and viral infections |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | C57BL/6 mice |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
| Assay used | NA |
| PMID | 21945041 |
| Year of Publication | 2011 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0886 |
| Ligand Name | Fimbriae H protein (FimH) |
| Source | Uropathogenic E.coli (Bacteria) |
| Sequence of ligand | MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Length | 300 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | stimulate the innate immune system and elicits protective responses against bacterial and viral infections |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | C57BL/6 mice |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
| Assay used | NA |
| PMID | 21945041 |
| Year of Publication | 2011 |
| Pubchem assay | Pubchem Assay |