Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0699 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0699 |
| Ligand Name | N1L |
| Source | Vaccinia(virus) |
| Sequence of ligand | MRTLLIRYILWRNDNDQTYYNDDFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK |
| Length | 117 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Suppress IRF3 activation (Bind to TBK1) |
| Name of receptor | The class II transactivator (CIITA) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | Human |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | P33076.fasta |
| Swiss prot ID | P33076 |
| Length Of Receptor | 1130 |
| Function | Suppress IFN production |
| Assay used | NA |
| PMID | 20672047 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information | |
|---|---|
| PRRID | PRRID_0699 |
| Ligand Name | N1L |
| Source | Vaccinia(virus) |
| Sequence of ligand | MRTLLIRYILWRNDNDQTYYNDDFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK |
| Length | 117 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Suppress IRF3 activation (Bind to TBK1) |
| Name of receptor | The class II transactivator (CIITA) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | Human |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | P33076.fasta |
| Swiss prot ID | P33076 |
| Length Of Receptor | 1130 |
| Function | Suppress IFN production |
| Assay used | NA |
| PMID | 20672047 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |