| Primary information |
|---|
| PRRID | PRRID_0564 |
| Ligand Name | HMGB1 |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induced cellular activation and NF-κB-dependent transcription |
| Name of receptor | Toll-like receptor 2 (TLR2)/Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | HEK293 |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It generate the inflammatory response similar to intiated by LPS |
| Assay used | NA |
| PMID | 20689929 |
| Year of Publication | 2010 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0564 |
| Ligand Name | HMGB1 |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induced cellular activation and NF-κB-dependent transcription |
| Name of receptor | Toll-like receptor 2 (TLR2)/Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | HEK293 |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It generate the inflammatory response similar to intiated by LPS |
| Assay used | NA |
| PMID | 20689929 |
| Year of Publication | 2010 |
| Pubchem assay | NA |