Primary information |
---|
PRRID | PRRID_0562 |
Ligand Name | HMGB1 |
Source | Human (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It interacts with the TLR4 and elicit immune response |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Rat |
Localization | Endothelial cells |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q9QX05.fasta |
Swiss prot ID | Q9QX05 |
Length Of Receptor | 835 |
Function | It induced vascular endothelial activation |
Assay used | EMSA |
PMID | 20714791 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |
Primary information |
---|
PRRID | PRRID_0562 |
Ligand Name | HMGB1 |
Source | Human (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It interacts with the TLR4 and elicit immune response |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Rat |
Localization | Endothelial cells |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q9QX05.fasta |
Swiss prot ID | Q9QX05 |
Length Of Receptor | 835 |
Function | It induced vascular endothelial activation |
Assay used | EMSA |
PMID | 20714791 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |