Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0562 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0562 |
| Ligand Name | HMGB1 |
| Source | Human (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It interacts with the TLR4 and elicit immune response |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Rat |
| Localization | Endothelial cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QX05.fasta |
| Swiss prot ID | Q9QX05 |
| Length Of Receptor | 835 |
| Function | It induced vascular endothelial activation |
| Assay used | EMSA |
| PMID | 20714791 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information | |
|---|---|
| PRRID | PRRID_0562 |
| Ligand Name | HMGB1 |
| Source | Human (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It interacts with the TLR4 and elicit immune response |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Rat |
| Localization | Endothelial cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QX05.fasta |
| Swiss prot ID | Q9QX05 |
| Length Of Receptor | 835 |
| Function | It induced vascular endothelial activation |
| Assay used | EMSA |
| PMID | 20714791 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |