| Primary information |
|---|
| PRRID | PRRID_0506 |
| Ligand Name | FimH |
| Source | Escherichia coli strain EC99 (O78) (Bacteria) |
| Sequence of ligand | MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Length | 300 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It activates both NK cells to induce cytokines [interferon (IFN)-γ and tumor necrosis factor (TNF)-α] and cytotoxicity |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Natural Killer cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | It aids innate protection against cancer or microbial infections. |
| Assay used | Chromium (51Cr) release assay for NK cytotoxicity |
| PMID | 20442710 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0506 |
| Ligand Name | FimH |
| Source | Escherichia coli strain EC99 (O78) (Bacteria) |
| Sequence of ligand | MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Length | 300 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It activates both NK cells to induce cytokines [interferon (IFN)-γ and tumor necrosis factor (TNF)-α] and cytotoxicity |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Natural Killer cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | It aids innate protection against cancer or microbial infections. |
| Assay used | Chromium (51Cr) release assay for NK cytotoxicity |
| PMID | 20442710 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |