| Primary information |
|---|
| PRRID | PRRID_0499 |
| Ligand Name | F protein |
| Source | Respiratory syncytial virus (virus) |
| Sequence of ligand | LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNIC |
| Length | 153 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | It coauses the inflammation |
| Assay used | NA |
| PMID | 20740341 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0499 |
| Ligand Name | F protein |
| Source | Respiratory syncytial virus (virus) |
| Sequence of ligand | LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNIC |
| Length | 153 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | It coauses the inflammation |
| Assay used | NA |
| PMID | 20740341 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |