| Primary information |
|---|
| PRRID | PRRID_0457 |
| Ligand Name | Curli (amyloid fibrils) |
| Source | E. coli strain MC4100(Bacteria) |
| Sequence of ligand | MNTLLLLAALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS |
| Length | 110 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | The binding of curli mediates the immune respionse cooperatively |
| Name of receptor | Toll-like receptor 2/1 (TLR2/1) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | cervical cancer |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It elicits the immune response via NF- |
| Assay used | ELISA |
| PMID | 20497180 |
| Year of Publication | 2010 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0457 |
| Ligand Name | Curli (amyloid fibrils) |
| Source | E. coli strain MC4100(Bacteria) |
| Sequence of ligand | MNTLLLLAALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS |
| Length | 110 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | The binding of curli mediates the immune respionse cooperatively |
| Name of receptor | Toll-like receptor 2/1 (TLR2/1) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | cervical cancer |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It elicits the immune response via NF- |
| Assay used | ELISA |
| PMID | 20497180 |
| Year of Publication | 2010 |
| Pubchem assay | NA |