| Primary information |
|---|
| PRRID | PRRID_0428 |
| Ligand Name | BsaK |
| Source | Burkholderia pseudomallei(Bacteria) |
| Sequence of ligand | MVRLPDRHRPRVRRRREGSEQAVAGRPGEPHEKPERSDRARQLSDDHVRIQPVPERAEQRGQIDEGHRFVDRLELPLTLSTAPGRRGASRAAPGRTIMNITNPHAVPALPSLSEIESPERPATLDAILKQTLADANEKSNAAKTSIESRLADPVDFAQSEKLIALQTELSDYSIYVSLASTLARKAVSAVETLVKAQ |
| Length | 197 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It activates caspase-1 through NLRC4 and secrete IL-1β |
| Name of receptor | Nod-like receptor C4 (NLRC4) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | Mice |
| Localization | Bone marrow–derived macrophages |
| Domain | NA |
| Sequence of Receptor | Q3UP24.fasta |
| Swiss prot ID | Q3UP24 |
| Length Of Receptor | 1024 |
| Function | It leads to the clearance of the pathogen from the system |
| Assay used | ELISA |
| PMID | 20133635 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0428 |
| Ligand Name | BsaK |
| Source | Burkholderia pseudomallei(Bacteria) |
| Sequence of ligand | MVRLPDRHRPRVRRRREGSEQAVAGRPGEPHEKPERSDRARQLSDDHVRIQPVPERAEQRGQIDEGHRFVDRLELPLTLSTAPGRRGASRAAPGRTIMNITNPHAVPALPSLSEIESPERPATLDAILKQTLADANEKSNAAKTSIESRLADPVDFAQSEKLIALQTELSDYSIYVSLASTLARKAVSAVETLVKAQ |
| Length | 197 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It activates caspase-1 through NLRC4 and secrete IL-1β |
| Name of receptor | Nod-like receptor C4 (NLRC4) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | Mice |
| Localization | Bone marrow–derived macrophages |
| Domain | NA |
| Sequence of Receptor | Q3UP24.fasta |
| Swiss prot ID | Q3UP24 |
| Length Of Receptor | 1024 |
| Function | It leads to the clearance of the pathogen from the system |
| Assay used | ELISA |
| PMID | 20133635 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |