| Primary information |
|---|
| PRRID | PRRID_0420 |
| Ligand Name | Ax21 |
| Source | Xanthomonas oryzae oryzae (plant) |
| Sequence of ligand | MLALGLLAALPFAASAAENLSYNFVEGDYVRTPTDGRDADGWGVKASYAVAPNFHVFGEYSKQNADDNNNLFENTNFDFQQWGVGVGFNHEIATSTDFVARVAYRRLDLDSPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDYSKKRGIDAGNDFYGRLGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW |
| Length | 194 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It triggered the PAMP mediated immunity |
| Name of receptor | XA21 |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | Rice |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | Q1MX30.fasta |
| Swiss prot ID | Q1MX30 |
| Length Of Receptor | 1025 |
| Function | It provides the immunity to the plant against the pathogen by recognizing the PAMP |
| Assay used | NA |
| PMID | 20713980 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0420 |
| Ligand Name | Ax21 |
| Source | Xanthomonas oryzae oryzae (plant) |
| Sequence of ligand | MLALGLLAALPFAASAAENLSYNFVEGDYVRTPTDGRDADGWGVKASYAVAPNFHVFGEYSKQNADDNNNLFENTNFDFQQWGVGVGFNHEIATSTDFVARVAYRRLDLDSPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDYSKKRGIDAGNDFYGRLGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW |
| Length | 194 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It triggered the PAMP mediated immunity |
| Name of receptor | XA21 |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | Rice |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | Q1MX30.fasta |
| Swiss prot ID | Q1MX30 |
| Length Of Receptor | 1025 |
| Function | It provides the immunity to the plant against the pathogen by recognizing the PAMP |
| Assay used | NA |
| PMID | 20713980 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |