| Primary information |
|---|
| PRRID | PRRID_0410 |
| Ligand Name | Alpha toxin |
| Source | S. aureus (Bacteria) |
| Sequence of ligand | SDYYPRNSVDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWK |
| Length | 71 |
| Type | toxin |
| Occurence | Natural |
| Role of Ligand | It’s binding to the NLRP3 leads to the activation of caspase-1, which in result lead to the maturation of IL-1β |
| Name of receptor | Nod-like receptor P3 (NLRP3) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | NA |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | it activates the inflammasome via NLRP3 |
| Assay used | NA |
| PMID | 20303873 |
| Year of Publication | 2010 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0410 |
| Ligand Name | Alpha toxin |
| Source | S. aureus (Bacteria) |
| Sequence of ligand | SDYYPRNSVDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWK |
| Length | 71 |
| Type | toxin |
| Occurence | Natural |
| Role of Ligand | It’s binding to the NLRP3 leads to the activation of caspase-1, which in result lead to the maturation of IL-1β |
| Name of receptor | Nod-like receptor P3 (NLRP3) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | NA |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | it activates the inflammasome via NLRP3 |
| Assay used | NA |
| PMID | 20303873 |
| Year of Publication | 2010 |
| Pubchem assay | NA |