Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_0410 details |
Primary information | |
---|---|
PRRID | PRRID_0410 |
Ligand Name | Alpha toxin |
Source | S. aureus (Bacteria) |
Sequence of ligand | SDYYPRNSVDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWK |
Length | 71 |
Type | toxin |
Occurence | Natural |
Role of Ligand | It’s binding to the NLRP3 leads to the activation of caspase-1, which in result lead to the maturation of IL-1β |
Name of receptor | Nod-like receptor P3 (NLRP3) |
Type of receptor | NOD-like receptor (NLR) |
Source | NA |
Localization | NA |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | it activates the inflammasome via NLRP3 |
Assay used | NA |
PMID | 20303873 |
Year of Publication | 2010 |
Pubchem assay | NA |
Primary information | |
---|---|
PRRID | PRRID_0410 |
Ligand Name | Alpha toxin |
Source | S. aureus (Bacteria) |
Sequence of ligand | SDYYPRNSVDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWK |
Length | 71 |
Type | toxin |
Occurence | Natural |
Role of Ligand | It’s binding to the NLRP3 leads to the activation of caspase-1, which in result lead to the maturation of IL-1β |
Name of receptor | Nod-like receptor P3 (NLRP3) |
Type of receptor | NOD-like receptor (NLR) |
Source | NA |
Localization | NA |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | it activates the inflammasome via NLRP3 |
Assay used | NA |
PMID | 20303873 |
Year of Publication | 2010 |
Pubchem assay | NA |