| Primary information |
|---|
| PRRID | PRRID_0270 |
| Ligand Name | Acute-phase serum amyloid A (SAA) |
| Source | Human (others) |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | TLR2 responded to SAA with potent activation of NF-κB, moreover it increased phosphorylation of MAP kinases and accelerated IκBα degradation. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | Macrophages |
| Domain | Ectodomain |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | It is resoonsible for the immuno-inflammation in the host cell. |
| Assay used | Solid-phase binding assay and NF-κB luciferase report assay |
| PMID | 18566366 |
| Year of Publication | 2008 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0270 |
| Ligand Name | Acute-phase serum amyloid A (SAA) |
| Source | Human (others) |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | TLR2 responded to SAA with potent activation of NF-κB, moreover it increased phosphorylation of MAP kinases and accelerated IκBα degradation. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | Macrophages |
| Domain | Ectodomain |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | It is resoonsible for the immuno-inflammation in the host cell. |
| Assay used | Solid-phase binding assay and NF-κB luciferase report assay |
| PMID | 18566366 |
| Year of Publication | 2008 |
| Pubchem assay | Pubchem Assay |