Primary information |
---|
PRRID | PRRID_0217 |
Ligand Name | tGPI-mucin |
Source | Trypanosoma (others) |
Sequence of ligand | MKWSALNMNEGRGQLNCFCDGYWLHFPWTNNPRDVRGSSFFCYFAFVLLCALHLLLCVCVPSVRGADTTDRSRRMCMRWSLVCRSCLHLPLPSMCWCCGRAVCVCVCVCLLPWIGVCVVRGVRRTVHAWLLPSPHVVCPLCVCLPHLSSPLLLSISLTVQISSTPLNDHTMMTTCRLLCALLVLALCCCPFLCVTATGTAKELNKADASAPSPPSNPPATTTGESGLQDVVSAAEPQDVDGDVRGTSGSETQSDGAADKSQKHDNNDTTGSQGSTNRSADQTDQNGEDPAATTTTTTTAPVAPSTTTTTEAPTTTTTRAPSRLREIDGSLSSSAWVCAPLLLAASALAYTTVG |
Length | 353 |
Type | Glycoprotein |
Occurence | Natural |
Role of Ligand | It induces the secretion of TNF-alpha and IL-12, which leads the production of cytokine IFN-gamma |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | NA |
Localization | NA |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | It leads to the production of the IFN-gamma, which is a key cytokine in host resistance to infection with T. cruzi. |
Assay used | NA |
PMID | 15361229 |
Year of Publication | 2004 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_0217 |
Ligand Name | tGPI-mucin |
Source | Trypanosoma (others) |
Sequence of ligand | MKWSALNMNEGRGQLNCFCDGYWLHFPWTNNPRDVRGSSFFCYFAFVLLCALHLLLCVCVPSVRGADTTDRSRRMCMRWSLVCRSCLHLPLPSMCWCCGRAVCVCVCVCLLPWIGVCVVRGVRRTVHAWLLPSPHVVCPLCVCLPHLSSPLLLSISLTVQISSTPLNDHTMMTTCRLLCALLVLALCCCPFLCVTATGTAKELNKADASAPSPPSNPPATTTGESGLQDVVSAAEPQDVDGDVRGTSGSETQSDGAADKSQKHDNNDTTGSQGSTNRSADQTDQNGEDPAATTTTTTTAPVAPSTTTTTEAPTTTTTRAPSRLREIDGSLSSSAWVCAPLLLAASALAYTTVG |
Length | 353 |
Type | Glycoprotein |
Occurence | Natural |
Role of Ligand | It induces the secretion of TNF-alpha and IL-12, which leads the production of cytokine IFN-gamma |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | NA |
Localization | NA |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | It leads to the production of the IFN-gamma, which is a key cytokine in host resistance to infection with T. cruzi. |
Assay used | NA |
PMID | 15361229 |
Year of Publication | 2004 |
Pubchem assay | NA |