| Primary information |
|---|
| PRRID | PRRID_0210 |
| Ligand Name | serum amyloid A |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Serum Amyloid A Is a Ligand for Scavenger Receptor Class B Type I and Inhibits High Density Lipoprotein Binding. |
| Name of receptor | Scavenger receptor B-1 (SR-B1) |
| Type of receptor | Scavenger receptor (SR) |
| Source | Mice |
| Localization | Hepatocytes |
| Domain | NA |
| Sequence of Receptor | Q61009.fasta |
| Swiss prot ID | Q61009 |
| Length Of Receptor | 509 |
| Function | SR-BI plays a key role in SAA metabolism through its ability to interact with and internalize SAA and, moreover, SAA influences HDL cholesterol metabolism through its inhibitory effects on SR-BI-mediated selective lipid. uptake |
| Assay used | NA |
| PMID | 15561721 |
| Year of Publication | 2004 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0210 |
| Ligand Name | serum amyloid A |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Serum Amyloid A Is a Ligand for Scavenger Receptor Class B Type I and Inhibits High Density Lipoprotein Binding. |
| Name of receptor | Scavenger receptor B-1 (SR-B1) |
| Type of receptor | Scavenger receptor (SR) |
| Source | Mice |
| Localization | Hepatocytes |
| Domain | NA |
| Sequence of Receptor | Q61009.fasta |
| Swiss prot ID | Q61009 |
| Length Of Receptor | 509 |
| Function | SR-BI plays a key role in SAA metabolism through its ability to interact with and internalize SAA and, moreover, SAA influences HDL cholesterol metabolism through its inhibitory effects on SR-BI-mediated selective lipid. uptake |
| Assay used | NA |
| PMID | 15561721 |
| Year of Publication | 2004 |
| Pubchem assay | Pubchem Assay |