Primary information |
---|
PRRID | PRRID_0170 |
Ligand Name | HCV E1 glycoproteins |
Source | Hepatitis C Virus (virus) |
Sequence of ligand | DAWDMMMNWSPTTALVVSQLLRIPQAVVDIVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGTQTTGRVAARNAHGFTSLFSPGASQNLQLINTNGSWHINR |
Length | 106 |
Type | Glycoprotein |
Occurence | Natural |
Role of Ligand | triggers immune responses |
Name of receptor | DC-SIGNR (Dendritic cell-specific ICAM-3-grabbing nonintegrin related protein) |
Type of receptor | C type Lectin (CTL/CLR) |
Source | Human |
Localization | endothelial cell populations, including hepatic sinusoidal endothelial cells |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | functions as an attachment factor for HIV and is expressed on liver sinusoidal endothelial cells |
Assay used | enzyme-linked immunosorbent assay |
PMID | 12634366 |
Year of Publication | 2003 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_0170 |
Ligand Name | HCV E1 glycoproteins |
Source | Hepatitis C Virus (virus) |
Sequence of ligand | DAWDMMMNWSPTTALVVSQLLRIPQAVVDIVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGTQTTGRVAARNAHGFTSLFSPGASQNLQLINTNGSWHINR |
Length | 106 |
Type | Glycoprotein |
Occurence | Natural |
Role of Ligand | triggers immune responses |
Name of receptor | DC-SIGNR (Dendritic cell-specific ICAM-3-grabbing nonintegrin related protein) |
Type of receptor | C type Lectin (CTL/CLR) |
Source | Human |
Localization | endothelial cell populations, including hepatic sinusoidal endothelial cells |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | functions as an attachment factor for HIV and is expressed on liver sinusoidal endothelial cells |
Assay used | enzyme-linked immunosorbent assay |
PMID | 12634366 |
Year of Publication | 2003 |
Pubchem assay | NA |