Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0170 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0170 |
| Ligand Name | HCV E1 glycoproteins |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | DAWDMMMNWSPTTALVVSQLLRIPQAVVDIVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGTQTTGRVAARNAHGFTSLFSPGASQNLQLINTNGSWHINR |
| Length | 106 |
| Type | Glycoprotein |
| Occurence | Natural |
| Role of Ligand | triggers immune responses |
| Name of receptor | DC-SIGNR (Dendritic cell-specific ICAM-3-grabbing nonintegrin related protein) |
| Type of receptor | C type Lectin (CTL/CLR) |
| Source | Human |
| Localization | endothelial cell populations, including hepatic sinusoidal endothelial cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | functions as an attachment factor for HIV and is expressed on liver sinusoidal endothelial cells |
| Assay used | enzyme-linked immunosorbent assay |
| PMID | 12634366 |
| Year of Publication | 2003 |
| Pubchem assay | NA |
| Primary information | |
|---|---|
| PRRID | PRRID_0170 |
| Ligand Name | HCV E1 glycoproteins |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | DAWDMMMNWSPTTALVVSQLLRIPQAVVDIVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGTQTTGRVAARNAHGFTSLFSPGASQNLQLINTNGSWHINR |
| Length | 106 |
| Type | Glycoprotein |
| Occurence | Natural |
| Role of Ligand | triggers immune responses |
| Name of receptor | DC-SIGNR (Dendritic cell-specific ICAM-3-grabbing nonintegrin related protein) |
| Type of receptor | C type Lectin (CTL/CLR) |
| Source | Human |
| Localization | endothelial cell populations, including hepatic sinusoidal endothelial cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | functions as an attachment factor for HIV and is expressed on liver sinusoidal endothelial cells |
| Assay used | enzyme-linked immunosorbent assay |
| PMID | 12634366 |
| Year of Publication | 2003 |
| Pubchem assay | NA |