Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0169 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0169 |
| Ligand Name | HCV E1 glycoproteins |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | DAWDMMMNWSPTTALVVSQLLRIPQAVVDIVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGTQTTGRVAARNAHGFTSLFSPGASQNLQLINTNGSWHINR |
| Length | 106 |
| Type | Glycoprotein |
| Occurence | Natural |
| Role of Ligand | triggers immune responses |
| Name of receptor | DC-SIGN (dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin) |
| Type of receptor | C type Lectin (CTL/CLR) |
| Source | Human |
| Localization | dendritic cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | promote HIV and Hepatitis C virus to infect T-cell from dendritic cells |
| Assay used | enzyme-linked immunosorbent assay |
| PMID | 12634366 |
| Year of Publication | 2003 |
| Pubchem assay | NA |
| Primary information | |
|---|---|
| PRRID | PRRID_0169 |
| Ligand Name | HCV E1 glycoproteins |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | DAWDMMMNWSPTTALVVSQLLRIPQAVVDIVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGTQTTGRVAARNAHGFTSLFSPGASQNLQLINTNGSWHINR |
| Length | 106 |
| Type | Glycoprotein |
| Occurence | Natural |
| Role of Ligand | triggers immune responses |
| Name of receptor | DC-SIGN (dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin) |
| Type of receptor | C type Lectin (CTL/CLR) |
| Source | Human |
| Localization | dendritic cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | promote HIV and Hepatitis C virus to infect T-cell from dendritic cells |
| Assay used | enzyme-linked immunosorbent assay |
| PMID | 12634366 |
| Year of Publication | 2003 |
| Pubchem assay | NA |