Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_0045 details |
Primary information | |
---|---|
PRRID | PRRID_0045 |
Ligand Name | surfactant protein-A |
Source | Host (Endogenous) (others) |
Sequence of ligand | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Length | 248 |
Type | Protein |
Occurence | Natural |
Role of Ligand | Carbohydrate moieties of SP-A enhanced adherence of Mycobacterium tuberculosis. |
Name of receptor | Mannose receptor |
Type of receptor | Mannose receptor (MR) |
Source | Human |
Localization | Alveolar macrophages |
Domain | NA |
Sequence of Receptor | P22897.fasta |
Swiss prot ID | P22897 |
Length Of Receptor | 1456 |
Function | Pulmonary surfactant protein A mediates enhanced phagocytosis of Mycobacterium tuberculosis. |
Assay used | NA |
PMID | 7594549 |
Year of Publication | 1995 |
Pubchem assay | Pubchem Assay |
Primary information | |
---|---|
PRRID | PRRID_0045 |
Ligand Name | surfactant protein-A |
Source | Host (Endogenous) (others) |
Sequence of ligand | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Length | 248 |
Type | Protein |
Occurence | Natural |
Role of Ligand | Carbohydrate moieties of SP-A enhanced adherence of Mycobacterium tuberculosis. |
Name of receptor | Mannose receptor |
Type of receptor | Mannose receptor (MR) |
Source | Human |
Localization | Alveolar macrophages |
Domain | NA |
Sequence of Receptor | P22897.fasta |
Swiss prot ID | P22897 |
Length Of Receptor | 1456 |
Function | Pulmonary surfactant protein A mediates enhanced phagocytosis of Mycobacterium tuberculosis. |
Assay used | NA |
PMID | 7594549 |
Year of Publication | 1995 |
Pubchem assay | Pubchem Assay |