| Primary information |
|---|
| PRRID | PRRID_0045 |
| Ligand Name | surfactant protein-A |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Length | 248 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Carbohydrate moieties of SP-A enhanced adherence of Mycobacterium tuberculosis. |
| Name of receptor | Mannose receptor |
| Type of receptor | Mannose receptor (MR) |
| Source | Human |
| Localization | Alveolar macrophages |
| Domain | NA |
| Sequence of Receptor | P22897.fasta |
| Swiss prot ID | P22897 |
| Length Of Receptor | 1456 |
| Function | Pulmonary surfactant protein A mediates enhanced phagocytosis of Mycobacterium tuberculosis. |
| Assay used | NA |
| PMID | 7594549 |
| Year of Publication | 1995 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0045 |
| Ligand Name | surfactant protein-A |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Length | 248 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Carbohydrate moieties of SP-A enhanced adherence of Mycobacterium tuberculosis. |
| Name of receptor | Mannose receptor |
| Type of receptor | Mannose receptor (MR) |
| Source | Human |
| Localization | Alveolar macrophages |
| Domain | NA |
| Sequence of Receptor | P22897.fasta |
| Swiss prot ID | P22897 |
| Length Of Receptor | 1456 |
| Function | Pulmonary surfactant protein A mediates enhanced phagocytosis of Mycobacterium tuberculosis. |
| Assay used | NA |
| PMID | 7594549 |
| Year of Publication | 1995 |
| Pubchem assay | Pubchem Assay |