Please wait...
| ID | PMID | YEAR | Sequence | MAP | Name | C-ter MOD | N-ter MOD | Linear/Cyclic | Stereo-Chemistry | Modified | Length | Fuction | Activity | RBCs Source | Origin | Experimental structure | Non-Hemolytic |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10924341 | 2000 | ILPWKWPWWPWRR{ct:Amid} | Indolicidin | Amidation | Free | Linear | L | None | 13 | Antibacterial | 100% hemolysis at 100μg/ml | Rat | Indolicidin of bovine neutrophil | NA | NA | ||
| 10924341 | 2000 | ILPWKLPLLPLRR{ct:Amid} | IL4 | Amidation | Free | Linear | L | None | 13 | Antibacterial | 0% hemolysis at 100μg/ml | Rat | Indolicidin analog of bovine neutrophil | NA | Non-hemolytic | ||
| 10924341 | 2000 | ILPLKLPWLPLRR{ct:Amid} | IL8 | Amidation | Free | Linear | L | None | 13 | Antibacterial | 0% hemolysis at 100μg/ml | Rat | Indolicidin analog of bovine neutrophil | NA | Non-hemolytic | ||
| 10924341 | 2000 | ILPLKLPLLPWRR{ct:Amid} | IL11 | Amidation | Free | Linear | L | None | 13 | Antibacterial | 0% hemolysis at 100μg/ml | Rat | Indolicidin analog of bovine neutrophil | NA | Non-hemolytic | ||
| 18942691 | 2008 | GFLSILKKVLPKVMAHMK{ct:Amid} | MEP | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 >100μM | Rat | Melectin isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLKKVMAHMK{ct:Amid} | MEP-1 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 =27.3μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLKVMAHMK{ct:Amid} | MEP-2 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | LC50 =22.9μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLAKVMAHMK{ct:Amid} | MEP-3 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 =29.7μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLGKVMAHMK{ct:Amid} | MEP-4 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 =41.1μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | KVMAHMK{ct:Amid} | MEP-5 | Amidation | Free | Linear | L | None | 7 | Antimicrobial | LC50 >100μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | PKVMAHMK{ct:Amid} | MEP-6 | Amidation | Free | Linear | L | None | 8 | Antimicrobial | LC50 >100μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | LPKVMAHMK{ct:Amid} | MEP-7 | Amidation | Free | Linear | L | None | 9 | Antimicrobial | LC50 >100μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | VLPKVMAHMK{ct:Amid} | MEP-8 | Amidation | Free | Linear | L | None | 10 | Antimicrobial | LC50 >100μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLP{ct:Amid} | MEP-9 | Amidation | Free | Linear | L | None | 11 | Antimicrobial | LC50 >100μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVL{ct:Amid} | MEP-10 | Amidation | Free | Linear | L | None | 10 | Antimicrobial | LC50 >100μM | Rat | Melectin analog isolated from the venom of the cleptoparasitic bee Melecta albifrons | NA | NA | ||
| 17114219 | 2007 | GIGAVLKVLTTGLPALISWIKRKRQQ{ct:Amid} | Melittin | Amidation | Free | Linear | L | None | 26 | Hemolytic | 100% hemolysis at 2μM | Rat | Melittin (venom of the european honey bee, Apis mellifera) | Random coil and α Helical | NA | ||
| 19843179 | 2009 | GMWSKIKNAGKAAKAAAKAAGKAALGAVSEAM | DRS-DA4 | Free | Free | Linear | L | None | 32 | Antimicrobial | 0% hemolysis at 1-100μM | Rat | Dermaseptin related protein from skin of the Mexican frog, Pachymedusa dacnicolor | α-helix | Non-hemolytic | ||
| 20499256 | 2010 | GFLSILKKVLPKVMAHMK{ct:Amid} | MEP | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 >100μM | Rat | Melectin from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSILKKVLPKV-{nnr:Met(O)}-AH-{nnr:Met(O)}-K{ct:Amid} | [Met (O)14,17] MEP | Amidation | Free | Linear | L | Met(O) = methionine sulfoxide | 18 | Antimicrobial | LC50 >200μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSILKKVLPKV-{nnr:Met(O2)}-AH-{nnr:Met(O2)}-K{ct:Amid} | [Met (O2)14,17] MEP | Amidation | Free | Linear | L | Met(O2) = methionine sulfone | 18 | Antimicrobial | LC50 >200μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSILKKVLPKV-{nnr:Nle}-AH-{nnr:Nle}-K{ct:Amid} | [Nle14,17] MEP | Amidation | Free | Linear | L | Nle = Norleucine | 18 | Antimicrobial | LC50 =50μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSLLKKVLPKV-Met-AH-{nnr:Nle}-K{ct:Amid} | [Nle17] MEP | Amidation | Free | Linear | L | Nle = Norleucine | 18 | Antimicrobial | LC50 =80μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSILKKVLPKV-{nnr:Nle}-AH-{nnr:Met(O)}-K{ct:Amid} | [Nle14, Met(O)17] MEP | Amidation | Free | Linear | L | Nle = Norleucine, Met(O) = methionine sulfoxide | 18 | Antimicrobial | LC50 >200μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSILKKVLPKV-{nnr:Nle}-AH-Met-K{ct:Amid} | [Nle14] MEP | Amidation | Free | Linear | L | Nle = Norleucine | 18 | Antimicrobial | LC50 =56.3μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSIVKKVLPKV-{nnr:Nle}-AH-{nnr:Met(O)}-K{ct:Amid} | [Val6, Nle14, Met(O)17] MEP | Amidation | Free | Linear | L | Nle = Norleucine, Met(O) = methionine sulfoxide | 18 | Antimicrobial | LC50 >200μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 20499256 | 2010 | GFLSIVKKVLPKV-{nnr:Nle}-AH-Met(O)-K{ct:Amid} | [Val6, Nle14] MEP | Amidation | Free | Linear | L | Nle = Norleucine | 18 | Antimicrobial | LC50 >200μM | Rat | Melectin derivative from venom of the cleptoparasitic bee Melecta albifrons | α Helix | NA | ||
| 15052574 | 2004 | I/LNWLKLGKAIIDAI/L{ct:Amid} | Agelaia-MP | Amidation | Free | Linear | L | None | 14 | Inflammatory | 75% hemolysis at 1 x10-6 M | Rat | Mastoparan (venom of the wasp Agelaia pallipes pallipes) | NA | NA | ||
| 15150833 | 2004 | INWLKLGKMVIDAL{ct:Amid} | 13a | Amidation | Free | Linear | L | None | 14 | Inflammatory | 100% hemolysis at 6.2x10-5 M | Rat | Mastoparan (venom of the social wasp Polybia paulista) | NA | NA | ||
| 15150833 | 2004 | IDWLKLGKMVMDVL{ct:Amid} | 13b | Amidation | Free | Linear | L | None | 14 | Inflammatory | 100% hemolysis at 6.2x10-5 M | Rat | Mastoparan (venom of the social wasp Polybia paulista) | NA | NA | ||
| 15225564 | 2004 | ILGTILGLLKGL{ct:Amid} | Protonectin | Amidation | Free | Linear | L | None | 12 | Chemotactic | >40% hemolysis at 10-4 M | Rat | Mastoparan (venom of the neotropical social wasp Agelaia pallipes pallipes) | NA | NA | ||
| 15225564 | 2004 | INWLKLGKAIIDAL{ct:Amid} | Agelaia-MP | Amidation | Free | Linear | L | None | 14 | Mast cell degranulating toxin | ~90% hemolysis at 10-4 M | Rat | Mastoparan (venom of the neotropical social wasp Agelaia pallipes pallipes) | NA | NA | ||
| 15581688 | 2005 | INWKKMAAATALKMI{ct:Amid} | MP | Amidation | Free | Linear | L | None | 15 | Hemolytic | 40% hemolysis at 10µM | Rat | Venom of the Neotropical social wasp Protopolybia exigua (Saussure) | α-helical | NA | ||
| 15581688 | 2005 | INWLKLGKKVSAIL{ct:Amid} | MPI | Amidation | Free | Linear | L | None | 14 | Hemolytic | 40% hemolysis at 10µM | Rat | Venom of the Neotropical social wasp Protopolybia indica (Saussure) | α-helical | NA | ||
| 15822124 | 2005 | FRKLFRVYSNFLRGKLKL{nt:Acet}{ct:Amid} | P1buy | Amidation | Acetylation | Linear | L | None | 18 | Hemolytic | 62% hemolysis at 10µM | Rat | Protein Data Bank (PDB, 1buy) | α-helical | NA | ||
| 15822124 | 2005 | WYSEMKRNVQRLERAIEE{nt:Acet}{ct:Amid} | P1c3c | Amidation | Acetylation | Linear | L | None | 18 | Hemolytic | 18% hemolysis at 10µM | Rat | Protein Data Bank (PDB, 1c3c) | α-helical | NA | ||
| 15822124 | 2005 | RDAKELVELFFEEIRRAL{nt:Acet}{ct:Amid} | P1ihf | Amidation | Acetylation | Linear | L | None | 18 | Hemolytic | 46% hemolysis at 10µM | Rat | Protein Data Bank (PDB, 1ihf) | α-helical | NA | ||
| 15822124 | 2005 | KQLIRFLKRLDRNLWGLA{nt:Acet}{ct:Amid} | P1ill | Amidation | Acetylation | Linear | L | None | 18 | Hemolytic | 48% hemolysis at 10µM | Rat | Protein Data Bank (PDB, 1ill) | α-helical | NA | ||
| 15052574 | 2004 | I/LLGTILGLLKGI/L{ct:Amid} | Agelaia-CP | Amidation | Free | Linear | L | None | 15 | Inflammatory | 0% hemolysis at 1x10-5 M (non-hemolytic) | Rat | Mastoparan (Agelaia pallipes pallipes) | NA | Non-hemolytic | ||
| 15581688 | 2005 | INWKAIIEAAKQAL{ct:Amid} | MP II | Amidation | Free | Linear | L | None | 14 | Hemolytic | No hemolysis at 10µM (non-hemolytic) | Rat | Mastoparan (Parapolybia indica) | NA | Non-hemolytic | ||
| 15581688 | 2005 | INWLKLGKAVIDAL{ct:Amid} | MP III | Amidation | Free | Linear | L | None | 14 | Hemolytic | No hemolysis at 10µM (non-hemolytic) | Rat | Mastoparan (Parapolybia indica) | NA | Non-hemolytic | ||
| 15822124 | 2005 | NRLARHFRDIAGRVNQRL{nt:Acet}{ct:Amid} | P1c9k | Amidation | Acetylation | Linear | L | None | 18 | Hemolytic | Non-hemolytic | Rat | Protein Data Bank (PDB) | NA | Non-hemolytic | ||
| 15822124 | 2005 | LKDVEEAQQKIINIIRRL{nt:Acet}{ct:Amid} | P1qc7 | Amidation | Acetylation | Linear | L | None | 18 | Hemolytic | Non-hemolytic | Rat | Protein Data Bank (PDB) | NA | Non-hemolytic | ||
| 11168889 | 2000 | PKLLKTFLSKWIG | SPFK | Free | Free | Linear | L | None | 13 | Antimicrobial | 100% hemolysis at 30 µg/mL | Rat | Synthetic peptide | NA | NA | ||
| 11168889 | 2000 | GIWKSLFTKLLKG | Retro SPFK (RSac) | Free | Free | Linear | L | None | 13 | Antimicrobial | 95-100% hemolysis at 60 µg/mL | Rat | Synthetic peptide | NA | NA | ||
| 11168889 | 2000 | GIWKSLFTKLLKG{ct:Amid} | Retro SPFK amide (RSam) | Amidation | Free | Linear | L | None | 13 | Antimicrobial | 95-100% hemolysis at 60 µg/mL | Rat | Synthetic peptide | NA | NA | ||
| 11168889 | 2000 | PKLL{d}KTFL{d}SKWIG | Diastereo SPFK (DSac) | Free | Free | Linear | Mix | None | 13 | Antimicrobial | ~10% hemolsis at 60 µg/mL | Rat | Synthetic peptide | NA | NA | ||
| 11168889 | 2000 | PKLL{d}ETFL{d}SKWIG{ct:Amid} | Diastereo SPFK amide (DSam) | Amidation | Free | Linear | Mix | None | 13 | Antimicrobial | ~40 % hemolysis at 60 µg/mL | Rat | Synthetic peptide | NA | NA | ||
| 11892852 | 2001 | FLPLLAGLAANFLPKIFCKITRKC{cyc:N-C} | Brevinin 1E (B) | Free | Free | Cyclic | L | None | 24 | Antibacterial | 100% hemolysis at 0.7μM | Rat | Brevinin 1E from the skin secretions of Rana esculenta | NA | NA | ||
| 11892852 | 2001 | FLPLLAGLAANFLPKIFC-{nnr:Acm}-KITRKC-{nnr:Acm} | Brevinin1E linear (BL) | Free | Free | Linear | L | Acm = acetamidomethyl | 26 | Antibacterial | 100% hemolysis at 5μM | Rat | Synthetic brevinin 1E variants (Rana esculenta) | NA | NA | ||
| 11892852 | 2001 | FLPLLAGLCKITRKCAANFLPKIF{cyc:N-C} | Analog of brevinin 1E (BA) | Free | Free | Cyclic | L | None | 24 | Antibacterial | 100% hemolysis at 7μM | Rat | Synthetic brevinin 1E variants (Rana esculenta) | NA | NA | ||
| 11892852 | 2001 | FLPLLAGLC-{nnr:Acm}-KITRKC-{nnr:Acm}-AANFLPKIF | Linear analog of brevinin 1E (BAL) | Free | Free | Linear | L | Acm = acetamidomethyl | 26 | Antibacterial | Non-hemolytic | Rat | Synthetic brevinin 1E variants (Rana esculenta) | NA | Non-hemolytic | ||
| 15572194 | 2004 | SADLVKKIWDNPAL{nt:Acet}{ct:Amid} | Polybine-I | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial | 0% hemolysis at 100μM (non-hemolytic) | Rat | Polybine-I (From venom of Polybia paulista) | NA | Non-hemolytic | ||
| 15572194 | 2004 | SVDMVMKGLKIWPL{nt:Acet}{ct:Amid} | Polybine-II | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial | 0% hemolysis at 100μM (non-hemolytic) | Rat | Polybine-II (From venom of Polybia paulista) | NA | Non-hemolytic | ||
| 15546886 | 2005 | GCRFCCNCCPNMSGCGVCCRF | Bass Hepcidin | Free | Free | Linear | L | None | 21 | Antibacterial and Antifungal | 0% hemolysis at 100 µg/ml (non-hemolytic) | Rat | Bass hepcidin (Morone chrysops x Morone saxatilis) | NA | Non-hemolytic | ||
| 15222751 | 2004 | GLVTSLIKGAGKLLGGLFGSVTGGQS | DRP-PBN2 | Free | Free | Linear | L | None | 26 | Cytotoxic | 42% hemolytic at 50μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GLVTSLIKGAGKLLGGLFGSVTGGQS | DRP-PBN2 | Free | Free | Linear | L | None | 26 | Cytotoxic | 75% hemolytic at 100μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GVVTDLLNTAGGLLGNLVGSLSG{ct:Amid} | DRP-PD 3-6 | Amidation | Free | Linear | L | None | 23 | Cytotoxic | 43% hemolytic at 50μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GVVTDLLNTAGGLLGNLVGSLSG{ct:Amid} | DRP-PD 3-6 | Amidation | Free | Linear | L | None | 23 | Cytotoxic | 65% hemolytic at 100μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GLVTGLLKTAGKLLGDLFGSLSG{ct:Amid} | ANC [K8,12] - ANC | Amidation | Free | Linear | L | None | 23 | Cytotoxic | 22% hemolytic at 50μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GLVTGLLKTAGKLLGDLFGSLSG{ct:Amid} | ANC [K8,12] - ANC | Amidation | Free | Linear | L | None | 23 | Cytotoxic | 48% hemolytic at 100μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GVVTDLLKTAGKLLGNLVGSLSG{ct:Amid} | [K8,12] - DRP-PD 3-6 | Amidation | Free | Linear | L | None | 23 | Cytotoxic | 35% hemolytic at 50μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 15222751 | 2004 | GVVTDLLKTAGKLLGNLVGSLSG{ct:Amid} | [K8,12] – DRP-PD 3-6 | Amidation | Free | Linear | L | None | 23 | Cytotoxic | 71% hemolytic at 100μM | Rat | Dermaseptins (Frog skin) | NA | NA | ||
| 19960443 | 2010 | P{d}S{d}L{d}V{d}S{d}L{d}V{d}VQ{d}LV{d}{nnr:Δ-But}-A{d}L{d}L{d}O{d}T{d}H{d}R{d}-I-{nnr:Hse}-{nnr:dab}-K{nt:β-hydroxyoctanoyl-Δ-But} | Tolaasin | Free | β-hydroxyoctanoyl-Δ-But | Linear | Mix | Δ-But = 2,3-dehydro-2-aminobutyric acid, Hse = L-homoserine, dab = D-2,4-diaminobutyric acid | 18 | Hemolytic | 100% hemolysis at 0.53 μg/mL | Rat | Tolaasin (Pseudomonas tolaasii) | NA | NA | ||
| 21968924 | 2011 | GRPNPVNNKPT{nnr:*}PHPRL | formaecin I | Free | Free | Linear | L | * = α-GalNAc | 16 | Antimicrobial | <5% hemolytic at 100 μM | Rat | Synthetic peptides | NA | NA | ||
| 21968924 | 2011 | GRPNPVNNKPTPHPRL | Non-glycosylated formaecin I | Free | Free | Linear | L | None | 16 | Antimicrobial | <5% hemolytic at 100 μM | Rat | non-glycosylated analogs of native formaecin I | NA | NA | ||
| 21968924 | 2011 | GKPRPYSPRPT{nnr:*}SHPRPIRV | M-drosocin | Free | Free | Linear | L | * = α-GalNAc | 19 | Antimicrobial | <5% hemolytic at 100 μM | Rat | Synthetic peptides | NA | NA | ||
| 21968924 | 2011 | GKPRPYSPRPTSHPRPIRV | Non-glycosylated M-drosocin | Free | Free | Linear | L | None | 19 | Antimicrobial | <5% hemolytic at 100 μM | Rat | non-glycosylated analogs of native M-drosocin | NA | NA | ||
| 1362637 | 1992 | PKLLETFLSKWIG | SPF | Free | Free | Linear | L | None | 13 | Antibacterial | 10% hemolysis at 9μM | Rat | Seminalplasmin derivative | NA | NA | ||
| 1362637 | 1992 | PKLLKTFLSKWIG | SPFK | Free | Free | Linear | L | None | 13 | Antibacterial | 10% hemolysis at 9μM | Rat | SPF analog | NA | NA | ||
| 9273892 | 1997 | LALILRKIVTAL{nt:Fmoc}{ct:Amid} | FCR(3A) | Amidation | Fmoc | Linear | L | None | 13 | Antibacterial | 100% hemolysis at 8μg | Rat | Crabrolin (Vespa crabro) | NA | NA | ||
| 9273892 | 1997 | LALILRKIVTAL{ct:Amid} | CR(3A) | Amidation | Free | Linear | L | None | 13 | Antibacterial | ~90% hemolysis at 80μg | Rat | Crabrolin (Vespa crabro) | NA | NA | ||
| 9273892 | 1997 | LKLIPRKIVTAL{nt:Fmoc}{ct:Amid} | FCR(3K,6P) | Amidation | Fmoc | Linear | L | None | 13 | Antibacterial | ~60% hemolysis at 80μg | Rat | Crabrolin (Vespa crabro) | NA | NA | ||
| 9273892 | 1997 | LKLIPRKIVTAL{ct:Amid} | CR(3K,6P) | Amidation | Free | Linear | L | None | 13 | Antibacterial | Non-hemolytic | Rat | Crabrolin (Vespa crabro) | NA | Non-hemolytic | ||
| 9273892 | 1997 | LPLILRKIVTAL{nt:Fmoc}{ct:Amid} | FCR | Amidation | Fmoc | Linear | L | None | 13 | Antibacterial | ~80% hemolysis at 8μg | Rat | Crabrolin (Vespa crabro) | NA | NA | ||
| 9273892 | 1997 | LPLILRKIVTAL{ct:Amid} | CR | Amidation | Free | Linear | L | None | 13 | Antibacterial | Non-hemolytic | Rat | Crabrolin (Vespa crabro) | NA | Non-hemolytic | ||
| 10604598 | 1999 | PKLLKTFLSKWIG | SPFK | Free | Free | Linear | L | None | 13 | Antibacterial | 100% hemolysis at 65μg/ml | Rat | Synthetic peptide | NA | NA | ||
| 10604598 | 1999 | CKLLKTFLSKWIC{cyc:N-C} | SC | Free | Free | Cyclic | L | None | 13 | Antibacterial | 100% hemolysis at 40μg/ml | Rat | Synthetic peptide | NA | NA | ||
| 10604598 | 1999 | CKLLKTFLSKWIC{cyc:N-C}{ct:Amid} | SAC | Amidation | Free | Cyclic | L | None | 13 | Antibacterial | 100% hemolysis at 5μg/ml | Rat | Synthetic peptide | NA | NA | ||
| 11738089 | 2001 | FLPLILRKIVTAL{ct:Amid} | Crabrolin | Amidation | Free | Linear | L | None | 13 | Antimicrobial and Mast cell degranulating | No hemolysis (non hemolytic) | Rat | Crabrolin (venom of the Vespa xanthoptera and Vespa crabro) | α-helix | Non-hemolytic | ||
| 18942691 | 2008 | GFLSILKKVLPKVMAHMK{ct:Amid} | MEP | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 >100µM | Rat | Derived from venom of Melecta albifrons | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLKKVMAHMK{ct:Amid} | MEP-1 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 = 27.3µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLKVMAHMK{ct:Amid} | MEP-2 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | LC50 = 22.9µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLAKVMAHMK{ct:Amid} | MEP-3 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 = 29.7µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLGKVMAHMK{ct:Amid} | MEP-4 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | LC50 = 41.4µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | KVMAHMK{ct:Amid} | MEP-5 | Amidation | Free | Linear | L | None | 7 | Antimicrobial | LC50 >100µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | PKVMAHMK{ct:Amid} | MEP-6 | Amidation | Free | Linear | L | None | 8 | Antimicrobial | LC50 >100µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | LPKVMAHMK{ct:Amid} | MEP-7 | Amidation | Free | Linear | L | None | 9 | Antimicrobial | LC50 >100µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | VLPKVMAHMK{ct:Amid} | MEP-8 | Amidation | Free | Linear | L | None | 10 | Antimicrobial | LC50 >100µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVLP{ct:Amid} | MEP-9 | Amidation | Free | Linear | L | None | 11 | Antimicrobial | LC50 >100µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18942691 | 2008 | GFLSILKKVL{ct:Amid} | MEP-10 | Amidation | Free | Linear | L | None | 10 | Antimicrobial | LC50 >100µM | Rat | Melectin analog (Melecta albifrons) | NA | NA | ||
| 18000874 | 2007 | GLLNGLALRLGKRALKKIIKRLCR | Cryptonin | Free | Free | Linear | L | None | 24 | Antimicrobial | 5% hemolysis upto 200µg/ml | Rat | Cryptonin (Cryptotympana dubia) | NA | NA | ||
| 8849687 | 1996 | ILPWKWPWWPWRR{ct:Amid} | Indolicidin | Amidation | Free | Linear | L | None | 13 | Antimicrobial | ~20% hemolysis at 10µM | Rat | Derived from cytoplasmic granules of bovine neutrophils, | NA | NA | ||
| 8849687 | 1996 | ILPWKWPWWPWRR{ct:Amid} | Indolicidin | Amidation | Free | Linear | L | None | 13 | Antibacterial | ~90% hemolysis at 20µM | Rat | Derived from cytoplasmic granules of bovine neutrophils, | NA | NA | ||
| 8849687 | 1996 | ILPWKWPWWPWRR{ct:Amid} | Indolicidin | Amidation | Free | Linear | L | None | 13 | Antibacterial | ~100% hemolysis at 30µM | Rat | Derived from cytoplasmic granules of bovine neutrophils, | NA | NA | ||
| 8849687 | 1996 | ILAWKWAWWAWRR{ct:Amid} | ILA | Amidation | Free | Linear | L | None | 13 | Antibacterial | ~20% hemolysis at 5µM | Rat | Indolicidin analog | NA | NA | ||
| 8849687 | 1996 | ILAWKWAWWAWRR{ct:Amid} | ILA | Amidation | Free | Linear | L | None | 13 | Antibacterial | 100% hemolysis at 20µg/ml | Rat | Indolicidin analog | NA | NA | ||
| 8849687 | 1996 | ILPFKFPFFPFRR{ct:Amid} | ILF | Amidation | Free | Linear | L | None | 13 | Antibacterial | ~20% hemolysis upto 80µg/ml | Rat | Indolicidin analog | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 5% hemolysis at 30μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 20% hemolysis at 45μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 30% hemolysis at 60μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 50% hemolysis at 75μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 85% hemolysis at 120μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 90% hemolysis at 150μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 9009216 | 1997 | SLSRYAKLANRLANPKLLETFLSKWIG | SPLN | Free | Free | Linear | L | None | 27 | Antimicrobial | 100% hemolysis at 180μg/ml | Rat | Seminalplasmin (Bovine) | NA | NA | ||
| 10195441 | 1999 | PKLLKTFLSKWIG | SPFK | Free | Free | Linear | L | None | 13 | Antimicrobial | 100% hemolysis at 40μM | Rat | Synthetic Peptide | NA | NA | ||
| 10195441 | 2000 | PKLLKKFLKKWIG | K5 | Free | Free | Linear | L | None | 13 | Antimicrobial | 100% hemolysis at 175μM | Rat | Synthetic Peptide | NA | NA | ||
| 10195441 | 2001 | PKLLKTFLSKWKKIG | WKK | Free | Free | Linear | L | None | 15 | Antimicrobial | 100% hemolysis at 85μM | Rat | Synthetic Peptide | NA | NA | ||
| 10195441 | 2002 | PKLLKFLSKWIG | K3S | Free | Free | Linear | L | None | 12 | Antimicrobial | 100% hemolysis at 63μM | Rat | Synthetic Peptide | NA | NA | ||
| 10195441 | 2003 | PKLLKTFLKWIG | K3T | Free | Free | Linear | L | None | 12 | Antimicrobial | 100% hemolysis at >330μM | Rat | Synthetic Peptide | NA | NA | ||
| 10195441 | 2004 | PKLKTFLSKWIG | KTF | Free | Free | Linear | L | None | 12 | Antimicrobial | 0% hemolysis at 300μM | Rat | Synthetic Peptide | NA | Non-hemolytic | ||
| 10195441 | 2005 | PKLLKFLKWIG | K3 | Free | Free | Linear | L | None | 11 | Antimicrobial | 100% hemolysis at 365μM | Rat | Synthetic Peptide | NA | NA | ||
| 10217411 | 1999 | GLPALISWIKRKRQQG{ct:Amid} | MCF | Amidation | Free | Linear | L | None | 16 | Antimicrobial | 100% hemolysis at 100μg/ml | Rat | Synthetic Peptide | NA | NA | ||
| 10217411 | 1999 | GLKKLISWIKRAAQQG{ct:Amid} | MCFA | Amidation | Free | Linear | L | None | 16 | Antimicrobial | 100% hemolysis at 110μg/ml | Rat | Synthetic Peptide | NA | NA | ||
| 18375018 | 2000 | INWKKIFEKVKNLV{ct:Amid} | PDD-A | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIFQKVKNLV{ct:Amid} | PDD-A-1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIFEKVKDLV{ct:Amid} | PDD-A-2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | IDWKKIFEKVKNLV{ct:Amid} | PDD-A-3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | IDWKKIFEKVKDLV{ct:Amid} | PDD-A-4 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | IDWSKIFEKVKNLV{ct:Amid} | PDD-A-5 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWSSIFEKVKNLV{ct:Amid} | PDD-A-6 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWSSIFESVKNLV{ct:Amid} | PDD-A-7 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWSSIFESVSNLV{ct:Amid} | PDD-A-8 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIFEKVSNLV{ct:Amid} | PDD-A-9 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIFESVKNLV{ct:Amid} | PDD-A-10 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKSIFEKVKNLV{ct:Amid} | PDD-A-11 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | NIWKKIFEKVKNLV{ct:Amid} | PDD-A-12 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKILGAL{ct:Amid} | PDD-B | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =45μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKILGAI{ct:Amid} | PDD-B-1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =75μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLRLGRRILGAL{ct:Amid} | PDD-B-2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =25μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INFLKLGKKILGAL{ct:Amid} | PDD-B-3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >140μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKLGKKILGAL{ct:Amid} | PDD-B-4 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >140μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INSLKLGKKILGAL{ct:Amid} | PDD-B-5 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Polistes dorsalis dorsalis mastoparans (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKMMSAL{ct:Amid} | MP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =100μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKK-{nnr:Nle}-{nnr:Nle}-SAL{ct:Amid} | MP-1 | Amidation | Free | Linear | L | Nle = Nle | 14 | Antimicrobial | IC50 =43μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKLLSAL{ct:Amid} | MP-2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 =44μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKLLSAL{nt:Fmoc}{ct:Amid} | MP-3 | Amidation | Fmoc | Linear | L | None | 14 | Antimicrobial | IC50 =6μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKLLSAL{nt:Acet}{ct:Amid} | MP-4 | Amidation | Acetylation | Linear | L | None | 14 | Antimicrobial | IC50 =44μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKMMSAI{ct:Amid} | MP-5 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >100μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | SNWLKLGKKMMSAL{ct:Amid} | MP-6 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >>100μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKMMSAL{nt:Fmoc}{ct:Amid} | MP-7 | Amidation | Fmoc | Linear | L | None | 14 | Antimicrobial | IC50 =13μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKMMSAL{nt:Acet}{ct:Amid} | MP-8 | Amidation | Acetylation | Linear | L | None | 14 | Antimicrobial | IC50 >>100μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWLKLGKKMMSAL{ct:OH} | MP-9 | OH | Free | Linear | L | None | 14 | Antimicrobial | IC50 >>100μM | Rat | Mischocytarus phthisicus mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIASIGKEVLKAL{ct:Amid} | PMM | Amidation | Free | Linear | L | None | 16 | Antimicrobial | IC50 =80μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIASIGKEVLKAI{ct:Amid} | PMM-1 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | IC50 >100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | NWKKIASIGKEVLKAL{ct:Amid} | PMM-2 | Amidation | Free | Linear | L | None | 16 | Antimicrobial | IC50 >100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | WKKIASIGKEVLKAL{ct:Amid} | PMM-3 | Amidation | Free | Linear | L | None | 15 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | KKIASIGKEVLKAL{ct:Amid} | PMM-4 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | KIASIGKEVLKAL{ct:Amid} | PMM-5 | Amidation | Free | Linear | L | None | 13 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIASIGKEVLKA{ct:Amid} | PMM-6 | Amidation | Free | Linear | L | None | 16 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIASIGKEVLK{ct:Amid} | PMM-7 | Amidation | Free | Linear | L | None | 15 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKIASIGKEVL{ct:Amid} | PMM-8 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INQKKIASIGKEV{ct:Amid} | PMM-9 | Amidation | Free | Linear | L | None | 13 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | IWNKIAKSIGKVLEKAL{ct:Amid} | PMM-10 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | IC50 >100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | INWKKGKEVLKAL{ct:Amid} | PMM-11 | Amidation | Free | Linear | L | None | 13 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | NIWKKIASIAKEVLKAL{ct:Amid} | PMM-12 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | IC50 =32μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | KNWKKIASIGKEVLKAL{ct:Amid} | PMM-13 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 18375018 | 2000 | SNWKKIASIGKEVLKAL{ct:Amid} | PMM-14 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | IC50 >>100μM | Rat | Polistes major major mastoparan (Polistinae wasps ) | NA | NA | ||
| 16129513 | 2005 | IDWKKLLDAAKQIL{ct:Amid} | Polybia-MPI | Amidation | Free | Linear | L | None | 14 | Cytotoxic | EC50 =4.5 X10-5M | Rat | Venom of the tropical socialwasp P. paulista | NA | NA | ||
| 16129513 | 2005 | ILGTILGLLKSL{ct:Amid} | Polybia-CP | Amidation | Free | Linear | L | None | 12 | Cytotoxic | EC50 =4 X10-6M | Rat | Venom of the tropical socialwasp P. paulista | NA | NA | ||
| 24530880 | 2013 | FFGRLKSVWSAVKHGWKAAKSR | trichoplaxin | Free | Free | Linear | L | None | 22 | Antimicrobial | 50 % Hemolysis at >800 µM | Rat | Trichoplax Adhaerens | α-Helix | NA | ||
| 24796503 | 2014 | KLLKLLLKLWLKLLKLLL | Hel 13-5 | Free | Free | Linear | L | None | 18 | Pulmonary surfactant | ~100 % Hemolysis at 20 µM | Rat | Synthetic | α-Helix | NA | ||
| 24796503 | 2014 | KLLKLLL{d}K{d}L{d}LWLKL{d}LLKLLL | Hel 13-5D3 | Free | Free | Linear | Mix | Lowercase letters correspond to D-amino acids | 18 | Pulmonary surfactant | ~100 % Hemolysis at 20 µM | Rat | Synthetic | α-Helix | NA | ||
| 24796503 | 2014 | KLLKLLL{d}K{d}L{d}LWL{d}KL{d}LLKL{d}LL | Hel 13-5D5 | Free | Free | Linear | Mix | Lowercase letters correspond to D-amino acids | 18 | Pulmonary surfactant | 35 % Hemolysis at 30-50 µM | Rat | Synthetic | α-Helix | NA | ||
| 24411680 | 2014 | RKDVY{ct:Amid} | TP-5 | Amidation | Free | Linear | L | None | 5 | Anti-mycobacterial | 50 % Hemolysis at >2000 mg/L | Rat | Synthetic Immunomodulatory Pentapeptide Of Thymopentin | α-Helix | Non-hemolytic | ||
| 24411680 | 2014 | RRRRRR{ct:Amid} | RR-6 | Amidation | Free | Linear | L | None | 6 | Anti-mycobacterial | 50 % Hemolysis at >2000 mg/L | Rat | Synthetic Peptide | α-Helix | Non-hemolytic | ||
| 24411680 | 2014 | RKDVYRRRRRR{ct:Amid} | RR-11 | Amidation | Free | Linear | L | None | 11 | Anti-mycobacterial | 50 % Hemolysis at >2000 mg/L | Rat | Synthetic Modified Peptides Of Thymopentin | α-Helix | Non-hemolytic | ||
| 24411680 | 2014 | RRRRRRRKDVY{ct:Amid} | RY-11 | Amidation | Free | Linear | L | None | 11 | Anti-mycobacterial | 50 % Hemolysis at >2000 mg/L | Rat | Synthetic Modified Peptides Of Thymopentin | α-Helix | Non-hemolytic | ||
| 26028561 | 2015 | FKRLKKLFKKIWNWK{ct:Amid} | HPA3NT3 | Amidation | Free | Linear | L | None | 15 | Antimicrobial | 68.2 % Hemolysis at 250 µM | Rat | Helicobacter Pylori | α-Helix | NA | ||
| 26028561 | 2015 | GIGAVLVKLTTGLPALISWIKRKRQQ{ct:Amid} | Melittin | Amidation | Free | Linear | L | None | 26 | Antimicrobial | 100 % Hemolysis at 250 µM | Rat | Bee Venom | α-Helix | NA | ||
| 26028561 | 2015 | FKRLKKLISWIKRKRQQ{ct:Amid} | Hn-Mc | Amidation | Free | Linear | L | None | 17 | Antibacterial | 1.1 % Hemolysis at 250 µM | Rat | Hybrid Peptide | α-Helix | Low hemolytic | ||
| 26380930 | 2015 | LLKKLLKK{ct:Amid} | LK | Amidation | Free | Linear | L | None | 8 | Anti-mycobacterial | 50 % Hemolysis at >500 μg/ml | Rat | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 26380930 | 2015 | PLLKKLLKKP{ct:Amid} | PP | Amidation | Free | Linear | L | None | 10 | Anti-mycobacterial | 50 % Hemolysis at >500 μg/ml | Rat | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 26380930 | 2015 | CLLKKLLKKC{ct:Amid} | CC | Amidation | Free | Linear | L | None | 10 | Anti-mycobacterial | 50 % Hemolysis at >500 μg/ml | Rat | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 26380930 | 2015 | ILLKKLLKKI{ct:Amid} | II | Amidation | Free | Linear | L | None | 10 | Anti-mycobacterial | 50 % Hemolysis at >500 μg/ml | Rat | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 26380930 | 2015 | MLLKKLLKKM{ct:Amid} | MM | Amidation | Free | Linear | L | None | 10 | Anti-mycobacterial | 50 % Hemolysis at >500 μg/ml | Rat | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 26380930 | 2015 | WLLKKLLKKW{ct:Amid} | WW | Amidation | Free | Linear | L | None | 10 | Anti-mycobacterial | 50 % Hemolysis at 363 μg/ml | Rat | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 26700464 | 2016 | RTLAFVRFK | RTL-PA | Free | Free | Linear | L | None | 9 | Antimicrobial | 100 % Hemolysis at 1.4 ± 0.1 µM | Rat | Tissue-Factor Targeted Found In The Heavy Chain Of Factor Vii | α-Helix | NA | ||
| 26700464 | 2016 | RTLAFVRFK | RTL-PA | Free | Free | Linear | L | None | 9 | Antimicrobial | 400 % Hemolysis at 2.0 ± 0.1 µM | Rat | Tissue-Factor Targeted Found In The Heavy Chain Of Factor Vii | α-Helix | NA | ||
| 26802742 | 2016 | FIGALLRPALKLLA{ct:Amid} | Pxt-2 | Amidation | Free | Linear | L | None | 15 | Antibacterial | 2 % Hemolysis at 50 µM | Rat | X. Tropicalis Skin | α-Helix | NA | ||
| 26802742 | 2016 | FIGALLGPLLNLLK{ct:Amid} | Pxt-5 | Amidation | Free | Linear | L | None | 15 | Antibacterial | 69.8 % Hemolysis at 50 µM | Rat | X. Tropicalis Skin | α-Helix | NA | ||
| 26802742 | 2016 | NLLGSLLKTGLKVGSNLL{ct:Amid} | Pxt-12 | Amidation | Free | Linear | L | None | 18 | Antibacterial | 0 % Hemolysis at 50 µM | Rat | X. Tropicalis Skin | α-Helix | Non-hemolytic | ||
| 26802742 | 2016 | ALLKLAPRLLAGIF{ct:Amid} | Reverse Pxt-2 | Amidation | Free | Linear | L | None | 14 | Antibacterial | 1.5 % Hemolysis at 50 µM | Rat | X. Tropicalis Skin | α-Helix | NA | ||
| 26802742 | 2016 | KLLNLLPGLLAGIF{ct:Amid} | Reverse Pxt-5 | Amidation | Free | Linear | L | None | 14 | Antibacterial | 5.2 % Hemolysis at 50 µM | Rat | X. Tropicalis Skin | α-Helix | NA | ||
| 26802742 | 2016 | LLNSGVKLGTKLLSGLLN{ct:Amid} | Reverse Pxt-12 | Amidation | Free | Linear | L | None | 18 | Antimicrobial | 0 % Hemolysis at 50 µM | Rat | X. Tropicalis Skin | α-Helix | Non-hemolytic | ||
| 26802742 | 2016 | INLKALAALAKKIL{ct:Amid} | Mastoparan | Amidation | Free | Linear | L | None | 14 | Antibacterial | 13.5 % Hemolysis at 50 µM | Rat | Wasp Venom | α-Helix | NA | ||
| 26802742 | 2016 | GIGAVLKVLTTGLPALISWIKRKRQQ{ct:Amid} | Melittin | Amidation | Free | Linear | L | None | 26 | Antibacterial | 100 % Hemolysis at 10 µM | Rat | Bee Venom | α-Helix | NA | ||
| 27723187 | 2016 | RRRRRRRR{nt:CH3(CH2)16CO}{ct:Amid} | Str–R8 | Amidation | CH3(CH2)16CO | Linear | L | R8 = Octa-arginine | 8 | Cytotoxic | 55.68 % Hemolysis at 100 µg/mL | Rat | Cpp | α-Helix | NA | ||
| 27723187 | 2016 | {nnr:CH3}-(KWFETWFTEWPKKKRK)-{nnr:H3C}{nt:Acet-CH3}{ct:CH3-Amid} | CH3–Pep3–H3C | CH3-Amidation | Acetylation-CH3 | Linear | L | CH3 = CH3, H3C = H3C | 16 | Cytotoxic | 13.38 % Hemolysis at 100 µg/mL | Rat | Cpp | α-Helix | NA | ||
| 27723187 | 2016 | KLPVMACHKKKKKKHC{nt:Acet}{ct:Amid} | BipM–ACHK6HC | Amidation | Acetylation | Linear | L | None | 16 | Cytotoxic | 0.19 % Hemolysis at 100 µg/mL | Rat | Cpp | α-Helix | NA | ||
| 27723187 | 2016 | KLPVMARRRRRRRR{nt:Acet}{ct:Amid} | BipM–AR8 | Amidation | Acetylation | Linear | L | R8 = Octa-arginine | 14 | Cytotoxic | 1.78 % Hemolysis at 100 µg/mL | Rat | Cpp | α-Helix | NA | ||
| 27723187 | 2016 | AAVLLPVLLAAPACHKKKKKKHC{nt:Acet}{ct:Amid} | MTS–ACHK6HC | Amidation | Acetylation | Linear | L | None | 23 | Cytotoxic | 9.12 % Hemolysis at 100 µg/mL | Rat | Cpp | α-Helix | NA | ||
| 27723187 | 2016 | AAVLLPVLLAAPARRRRRRRR{nt:Acet}{ct:Amid} | MTS–AR8 | Amidation | Acetylation | Linear | L | R8 = Octa-arginine | 21 | Cytotoxic | 13.28 % Hemolysis at 100 µg/mL | Rat | Cpp | α-Helix | NA | ||
| 25546564 | 2016 | VRPPPASKSL | 1 | Free | Free | Linear | L | None | 10 | Antioxidant | <25 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 25546564 | 2016 | LPGGGHGDL | 2 | Free | Free | Linear | L | None | 10 | Antioxidant | <35 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 25546564 | 2016 | FLKMN | 3 | Free | Free | Linear | L | None | 5 | Antioxidant | 35 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 25546564 | 2016 | GKFNV | 4 | Free | Free | Linear | L | None | 5 | Antioxidant | <35 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 25546564 | 2016 | LPGGGT | 5 | Free | Free | Linear | L | None | 6 | Antioxidant | <45 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 25546564 | 2016 | HA | 6 | Free | Free | Linear | L | None | 2 | Antioxidant | 45 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 25546564 | 2016 | KEER | 7 | Free | Free | Linear | L | None | 4 | Antioxidant | <40 % Hemolysis at 1 mg/mL | Rat | Synthetic | NA | NA | ||
| 27450123 | 2017 | GFLSILKKVLPKVMAHMK{ct:Amid} | MEP(melectin) | Amidation | Free | Linear | L | None | 18 | Antimicrobial | 50 % Hemolysis at 100 µM | Rat | Cleptoparasitic Bee Melecta Albifrons | α-Helix | NA | ||
| 28546807 | 2017 | GFVALLKKLPLILKHLH{ct:Amid} | Xac-1 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | 37.5 ± 1.9 % Hemolysis at 100 µM | Rat | Venom Of X. Appendiculata | α-Helix | NA | ||
| 28546807 | 2017 | GFVALLKKLPLILKHLP{ct:Amid} | Xac-2 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | 23.5 ± 1.3 % Hemolysis at 100 µM | Rat | Venom Of X. Appendiculata | α-Helix | NA | ||
| 28546807 | 2017 | INLKALAALAKKIL{ct:Amid} | Mastoparan | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 40.6 ± 2.7 % Hemolysis at 100 µM | Rat | Wasp Venom | α-Helix | NA | ||
| 28546807 | 2017 | GIGAVLEVLTTGLPALISWIEEEEQQ{ct:Amid} | Melittin | Amidation | Free | Linear | L | None | 26 | Antimicrobial | 91.8 ± 1.8 % Hemolysis at 10 µM | Rat | Apis Mellifera | α-Helix | NA | ||
| 28656506 | 2017 | GKPRPYSPRPTSHPRPIRV | n-drosocin | Free | Free | Linear | L | None | 19 | Antibacterial | <10 % Hemolysis at 200 µM | Rat | Drosophila Melanogaster | Random coil | NA | ||
| 28656506 | 2017 | GKPRPYSPRPTSHPRPIRV | M-drosocin | Free | Free | Linear | L | None | 19 | Antibacterial | <10 % Hemolysis at 200 µM | Rat | Drosophila Melanogaster | Random coil | NA | ||
| 28656506 | 2017 | GKPRPYSPRPTSHPRPIRV | Di-drosocin | Free | Free | Linear | L | None | 19 | Antibacterial | <10 % Hemolysis at 200 µM | Rat | Drosophila Melanogaster | Random coil | NA | ||
| 37888622 | 2023 | INLLKIAKGIIKSL{ct:Amid} | EMP-AF | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Anterhynchium Flavormarginatum Micado | α-Helical | NA | ||
| 37888622 | 2023 | INLLKIAKGIIKSL{ct:Amid} | EMP-AF | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 122.1 ± 13.1 µM | Rat | Anterhynchium Flavormarginatum Micado | α-Helical | NA | ||
| 37888622 | 2023 | FDVMGIIKKIASAL{ct:Amid} | EMP-EF | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 48 % Hemolysis at 320 μg/mL | Rat | Eumenes Fraterculus | α-Helical | NA | ||
| 37888622 | 2023 | FDVMGIIKKIASAL{ct:Amid} | EMP-EF | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 216.8 ± 1.6 µM | Rat | Eumenes Fraterculus | α-Helical | NA | ||
| 37888622 | 2023 | FDIMGLIKKVAGAL{ct:Amid} | EMP-ER | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 46 % Hemolysis at 30 μg/mL | Rat | Eumenes Rubrofemoratus | α-Helical | NA | ||
| 37888622 | 2023 | FDIMGLIKKVAGAL{ct:Amid} | EMP-ER | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 230.6 ± 3.7 µM | Rat | Eumenes Rubrofemoratus | α-Helical | NA | ||
| 37888622 | 2023 | LNLKGLIKKVASLLN | Eumenitin-R | Free | Free | Linear | L | None | 15 | Antimicrobial | 7 % Hemolysis at 320 μg/mL | Rat | Eumenes Rubronotatus | α-Helical | NA | ||
| 37888622 | 2023 | LNLKGLFKKVASLLT | Eumenitin-F | Free | Free | Linear | L | None | 15 | Antimicrobial | 44 % Hemolysis at 320 μg/mL | Rat | Eumenes Rubronotatus | α-Helical | NA | ||
| 37888622 | 2023 | LNLKGIFKKVASLLT | Eumenitin | Free | Free | Linear | L | None | 15 | Antimicrobial | 4 % Hemolysis at 320 μg/mL | Rat | Eumenes Rubronotatus | α-Helical | NA | ||
| 37888622 | 2023 | LNLKGLFKKVASLLT | Eumenitin-F | Free | Free | Linear | L | None | 15 | Antimicrobial | 50 % Hemolysis at 207.1 ± 2.0 µM | Rat | Eumenes Rubronotatus | α-Helical | NA | ||
| 37888622 | 2023 | INLKGLIKKVASLLT | EpVP1 | Free | Free | Linear | L | None | 15 | Antimicrobial | 0 % Hemolysis at 320 μg/mL | Rat | Eumenes Pomiformis | α-Helical | Non-hemolytic | ||
| 37888622 | 2023 | FDLLGLVKKVASAL{ct:Amid} | EpVP2a | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 41 % Hemolysis at 320 μg/mL | Rat | Eumenes Pomiformis | α-Helical | NA | ||
| 37888622 | 2023 | FDLLGLVKSVVSAL{ct:Amid} | EpVP2b | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Eumenes Pomiformis | α-Helical | NA | ||
| 37888622 | 2023 | FDLLGLVKKVASAL{ct:Amid} | EpVP2a | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 238.8 ± 7.6 µM | Rat | Eumenes Pomiformis | α-Helical | NA | ||
| 37888622 | 2023 | FDLLGLVKSVVSAL{ct:Amid} | EpVP2b | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 50.6 ± 2.6 µM | Rat | Eumenes Pomiformis | α-Helical | NA | ||
| 37888622 | 2023 | LKLMGIVKKVLGAL{ct:Amid} | EMP-EM1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 7 % Hemolysis at 320 μg/mL | Rat | Eumenes Micado | α-Helical | NA | ||
| 37888622 | 2023 | LKLLGIVKKVLGAI{ct:Amid} | EMP-EM2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 2 % Hemolysis at 320 μg/mL | Rat | Eumenes Micado | α-Helical | NA | ||
| 37888622 | 2023 | GRILSFIKGLAEHL{ct:Amid} | EMP-OD | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 49 % Hemolysis at 320 μg/mL | Rat | Orancistrocerus Drewseni | α-Helical | NA | ||
| 37888622 | 2023 | KDLHTVVSAILQAL{ct:Amid} | OdVP3a | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 27 % Hemolysis at 320 μg/mL | Rat | Orancistrocerus Drewseni | α-Helical | NA | ||
| 37888622 | 2023 | INLKALAALAKKIL{ct:Amid} | Mastoparan (L) | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 41 % Hemolysis at 320 μg/mL | Rat | Vespula Lewisii | α-Helical | NA | ||
| 37888622 | 2023 | INLKALAALAKKIL{ct:Amid} | Mastoparan (L) | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 242.5 ± 2.6 µM | Rat | Vespula Lewisii | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIKSIIKAAMN{ct:Amid} | Mastoparan-V1 | Amidation | Free | Linear | L | None | 15 | Antimicrobial | 16 % Hemolysis at 320 μg/mL | Rat | Vespula Vulgaris | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIKSLIKAAMS{ct:Amid} | Mastoparan-V2 | Amidation | Free | Linear | L | None | 15 | Antimicrobial | 52 % Hemolysis at 320 μg/mL | Rat | Vespula Vulgaris | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIKSLIKAAMS{ct:Amid} | Mastoparan-V2 | Amidation | Free | Linear | L | None | 15 | Antimicrobial | 50 % Hemolysis at 182.4 ± 3.6 µM | Rat | Vespula Vulgaris | α-Helical | NA | ||
| 37888622 | 2023 | INMKASAAVAKKLL{ct:Amid} | MP-VB1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 7 % Hemolysis at 320 μg/mL | Rat | Vespa Bicolor | α-Helical | NA | ||
| 37888622 | 2023 | INMKAVAAVAKKPL{ct:Amid} | MP-VB2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 0 % Hemolysis at 320 μg/mL | Rat | Vespa Bicolor | α-Helical | Non-hemolytic | ||
| 37888622 | 2023 | INWKGIAAMAKKLL{ct:Amid} | Mastoparan-X(V) | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 70 % Hemolysis at 320 μg/mL | Rat | Vespa. Xanthoptera | α-Helical | NA | ||
| 37888622 | 2023 | INWKGIAAMAKKLL{ct:Amid} | Mastoparan-X(V) | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 156.5 ± 2.4 µM | Rat | Vespa. Xanthoptera | α-Helical | NA | ||
| 37888622 | 2023 | IKWKAILDAVKKVL{ct:Amid} | Mastoparan-A | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 56 % Hemolysis at 320 μg/mL | Rat | Vespa Analis | α-Helical | NA | ||
| 37888622 | 2023 | IKWKAILDAVKKVL{ct:Amid} | Mastoparan-A | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 183.0 ± 3.4 µM | Rat | Vespa Analis | α-Helical | NA | ||
| 37888622 | 2023 | LKLKSIVSWAKKVL{ct:Amid} | Mastoparan-B | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 19 % Hemolysis at 320 μg/mL | Rat | Vespa Basalis | α-Helical | NA | ||
| 37888622 | 2023 | INLKALLAVAKKIL{ct:Amid} | Mastoparan-C | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Vespa Crabro | α-Helical | NA | ||
| 37888622 | 2023 | INLKALLAVAKKIL{ct:Amid} | Mastoparan-C | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 64.4 ± 10.7 µM | Rat | Vespa Crabro | α-Helical | NA | ||
| 37888622 | 2023 | INLKALAALVKKVL{ct:Amid} | Mastoparan-II | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 90 % Hemolysis at 320 μg/mL | Rat | Vespa Orientalis | α-Helical | NA | ||
| 37888622 | 2023 | INLKAIAALVKKVL{ct:Amid} | HR1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 39 % Hemolysis at 320 μg/mL | Rat | Vespa Orientalis | α-Helical | NA | ||
| 37888622 | 2023 | INLKALAALVKKVL{ct:Amid} | Mastoparan-II | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 146.8 ± 3.4 µM | Rat | Vespa Orientalis | α-Helical | NA | ||
| 37888622 | 2023 | INLKAIAALVKKVL{ct:Amid} | HR1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 253.4 ± 13.0 µM | Rat | Vespa Orientalis | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIFQKVKNLV{ct:Amid} | PDD-A | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 27 % Hemolysis at 320 μg/mL | Rat | Polistes Dorsalis | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKILGAL{ct:Amid} | PDD-B | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polistes Dorsalis | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKILGAL{ct:Amid} | PDD-B | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 55.6 ± 4.1 µM | Rat | Polistes Dorsalis | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIAEIGKQVLSAL{ct:Amid} | Dominulin B | Amidation | Free | Linear | L | None | 17 | Antimicrobial | 8 % Hemolysis at 320 μg/mL | Rat | Polistes Dominulus | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIAEIGKQVLSAL{ct:Amid} | Dominulin B | Amidation | Free | Linear | L | None | 17 | Antimicrobial | 0 % Hemolysis at 320 μg/mL | Rat | Polistes Dominulus | α-Helical | Non-hemolytic | ||
| 37888622 | 2023 | INWLKLGKKILGAI{ct:Amid} | Pm-R1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 92 % Hemolysis at 320 μg/mL | Rat | Polistes Rothneyi Iwatai | α-Helical | NA | ||
| 37888622 | 2023 | LNFKALAALAKKIL{ct:Amid} | Pm-R2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 34 % Hemolysis at 320 μg/mL | Rat | Polistes Rothneyi Iwatai | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKQILGAL{ct:Amid} | Pm-R3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polistes Rothneyi Iwatai | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKILGAI{ct:Amid} | Pm-R1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 105.1 ± 2.2 µM | Rat | Polistes Rothneyi Iwatai | α-Helical | NA | ||
| 37888622 | 2023 | LNFKALAALAKKIL{ct:Amid} | Pm-R2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 249.5 ± 9.9 µM | Rat | Polistes Rothneyi Iwatai | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKQILGAL{ct:Amid} | Pm-R3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 73.5 ± 5.1 µM | Rat | Polistes Rothneyi Iwatai | α-Helical | NA | ||
| 37888622 | 2023 | INLKAIAAFAKKLL{ct:Amid} | Mastoparan-T(D) | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 19 % Hemolysis at 320 μg/mL | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLKVFAALVKKFL{ct:Amid} | Mastoparan-T1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 87 % Hemolysis at 320 μg/mL | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLKVFAALVKKLL{ct:Amid} | Mastoparan-T2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLRGFAALVKKFL{ct:Amid} | Mastoparan-T3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLFGFAALVKKFL{ct:Amid} | Mastoparan-T4 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLKVFAALVKKFL{ct:Amid} | Mastoparan-T1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 22.7 ± 7.1 µM | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLKVFAALVKKLL{ct:Amid} | Mastoparan-T2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 21.1 ± 2.4 µM | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLRGFAALVKKFL{ct:Amid} | Mastoparan-T3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 51.6 ± 2.1 µM | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INLFGFAALVKKFL{ct:Amid} | Mastoparan-T4 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 17.6 ± 2.4 µM | Rat | Vespa Tropica | α-Helical | NA | ||
| 37888622 | 2023 | INWKGIAAMKKLL{ct:Amid} | Mastoparan-like peptide 12b | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 0 % Hemolysis at 320 μg/mL | Rat | Vespa Magnifica | α-Helical | Non-hemolytic | ||
| 37888622 | 2023 | INLKAIAALAKKLL{ct:Amid} | Mastoparan-M | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 28 % Hemolysis at 320 μg/mL | Rat | Vespa Mandarinia | α-Helical | NA | ||
| 37888622 | 2023 | INLKAIAALAKKLF{ct:Amid} | Mastoparan AF | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 92 % Hemolysis at 320 μg/mL | Rat | Vespa Affinis | α-Helical | NA | ||
| 37888622 | 2023 | INLKAIAALAKKLF{ct:Amid} | Mastoparan AF | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 107.3 ± 15.7 µM | Rat | Vespa Affinis | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAIIDAL{ct:Amid} | Agelaia-MPI | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 98 % Hemolysis at 320 μg/mL | Rat | Agelaia Pallipes Pallipes | α-Helical | NA | ||
| 37888622 | 2023 | INWKAILQRIKKML{ct:Amid} | Agelaia-MPII | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 97 % Hemolysis at 320 μg/mL | Rat | Agelaia Pallipes Pallipes | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAIIDAL{ct:Amid} | Agelaia-MPI | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 7.0 ± 0.7 µM | Rat | Agelaia Pallipes Pallipes | α-Helical | NA | ||
| 37888622 | 2023 | INWKAILQRIKKML{ct:Amid} | Agelaia-MPII | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 62.1 ± 3.8 µM | Rat | Agelaia Pallipes Pallipes | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKMMSAL{ct:Amid} | MP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 10 % Hemolysis at 320 μg/mL | Rat | Mischocyttarus Phthisicus | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKVSAIL{ct:Amid} | Protopolybia-MP I | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 5 % Hemolysis at 320 μg/mL | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWKAIIEAAKQAL{ct:Amid} | ProtopolybiaMPII | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 24 % Hemolysis at 320 μg/mL | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVIDAL{ct:Amid} | ProtopolybiaMPIII | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 93 % Hemolysis at 320 μg/mL | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVIDAL{ct:Amid} | ProtopolybiaMPIII | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 34.6 ± 2.8 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWKALLDAAKKVL{ct:Amid} | ProtonectarinaMP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 35 % Hemolysis at 320 μg/mL | Rat | Protonectarina Sylveirae | α-Helical | NA | ||
| 37888622 | 2023 | INWKALLDAAKKVL{ct:Amid} | ProtonectarinaMP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 326.5 ± 26.4 µM | Rat | Protonectarina Sylveirae | α-Helical | NA | ||
| 37888622 | 2023 | IDWKKLLDAAKQIL{ct:Amid} | Polybia-MP I | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polybia Paulista | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKMVIDAL{ct:Amid} | Polybia-MP II | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polybia Paulista | α-Helical | NA | ||
| 37888622 | 2023 | IDWLKLGKMVMDVL{ct:Amid} | Polybia-MP III | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polybia Paulista | α-Helical | NA | ||
| 37888622 | 2023 | IDWLKLRVISVIDL{ct:Amid} | Polybia-MP IV | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 0 % Hemolysis at 320 μg/mL | Rat | Polybia Paulista | α-Helical | Non-hemolytic | ||
| 37888622 | 2023 | INWHDIAIKNIDAL{ct:Amid} | Polybia-MP V | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 0 % Hemolysis at 320 μg/mL | Rat | Polybia Paulista | α-Helical | Non-hemolytic | ||
| 37888622 | 2023 | IDWKKLLDAAKQIL{ct:Amid} | Polybia-MP I | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 51.4 ± 2.2 µM | Rat | Polybia Paulista | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKMVIDAL{ct:Amid} | Polybia-MP II | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 29.1 ± 1.5 µM | Rat | Polybia Paulista | α-Helical | NA | ||
| 37888622 | 2023 | IDWLKLGKMVMDVL{ct:Amid} | Polybia-MP III | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 74.8 ± 10.4 µM | Rat | Polybia Paulista | α-Helical | NA | ||
| 37888622 | 2023 | INWKKMAATALKMI{ct:Amid} | Parapolybia-MP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 22 % Hemolysis at 320 μg/mL | Rat | Parapolybia Indica | α-Helical | NA | ||
| 37888622 | 2023 | INWAKLGKLALQAL{ct:Amid} | Ropalidia-MP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 94 % Hemolysis at 320 μg/mL | Rat | Ropalidia | α-Helical | NA | ||
| 37888622 | 2023 | INWAKLGKLALQAL{ct:Amid} | Ropalidia-MP | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 122.2 ± 4.3 µM | Rat | Ropalidia | α-Helical | NA | ||
| 37888622 | 2023 | VDWKKIGQHILSVL{ct:Amid} | Mastoparan-J | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polistes Jadwigae | α-Helical | NA | ||
| 37888622 | 2023 | VDWKKIGQHILSVL{ct:Amid} | Mastoparan-J | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 60.1 ± 1.3 µM | Rat | Polistes Jadwigae | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIASIGKEVLKAL{ct:Amid} | PMM2 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | 100 % Hemolysis at 320 μg/mL | Rat | Polistes Major Major | α-Helical | NA | ||
| 37888622 | 2023 | INWKKIASIGKEVLKAL{ct:Amid} | PMM2 | Amidation | Free | Linear | L | None | 17 | Antimicrobial | 50 % Hemolysis at 80.9 ± 6.4 µM | Rat | Polistes Major Major | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKVIDAL{ct:Amid} | Protopolybia-MPIII-1 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 158.4 ± 2.3 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVSDAL{ct:Amid} | Protopolybia-MPIII-2 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 639.5 ± 1.6 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVIAAL{ct:Amid} | Protopolybia-MPIII-3 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 21.5 ± 1.2 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVIDIL{ct:Amid} | Protopolybia-MPIII-4 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 19.8 ± 1.2 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKVIAAL{ct:Amid} | Protopolybia-MPIII-6 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 107.6 ± 3.2 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKVIDIL{ct:Amid} | Protopolybia-MPIII-7 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 57.5 ± 2.7 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVSAAL{ct:Amid} | Protopolybia-MPIII-8 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 444.0 ± 2.1 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVSDIL{ct:Amid} | Protopolybia-MPIII-9 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 161.7 ± 1.3 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVIAIL{ct:Amid} | Protopolybia-MPIII-10 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 11.7 ± 1.0 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKAVSAIL{ct:Amid} | Protopolybia-MPIII-11 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 133.6 ± 2.2 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 37888622 | 2023 | INWLKLGKKVIAIL{ct:Amid} | Protopolybia-MPIII-12 | Amidation | Free | Linear | L | None | 14 | Antimicrobial | 50 % Hemolysis at 55.2 ± 2.2 µM | Rat | Protopolybia Exigua | α-Helical | NA | ||
| 38004789 | 2024 | KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVSFPF{ct:Amid} | Aquiluscidin | Amidation | Free | Linear | L | None | 34 | Antimicrobial | <2.3 % Hemolysis at | Rat | Crotalus Aquilus | α-Helical | NA | | ||
| 38004789 | 2024 | FFKKVKKSVKKRLKKIFKKPMVI{ct:Amid} | Vcn-23 | Amidation | Free | Linear | L | None | 23 | Antimicrobial | <1.2 % Hemolysis at | Rat | Derivative Peptide | α-Helical | NA | | ||
| 28918200 | 2018 | KIKEKLIEA{ct:Carboxyl (COO-)} | Pep-5 | Carboxyl (COO-) | Free | Linear | L | None | 9 | ND | 0 % Hemolysis at 125 μM | Rat | Scorpion Tityus Obscurus | NA | Non-hemolytic | ||
| 28918200 | 2018 | KPVEPVG{ct:Carboxyl (COO-)} | Pep-9 | Carboxyl (COO-) | Free | Linear | L | None | 7 | ND | ~25 % Hemolysis at 125 μM | Rat | Scorpion Tityus Obscurus | NA | NA | ||
| 28918200 | 2018 | VYWLPAVLGSLLGFTP{ct:Carboxyl (COO-)} | Pep-14 | Carboxyl (COO-) | Free | Linear | L | None | 16 | ND | 0 % Hemolysis at 125 μM | Rat | Scorpion Tityus Obscurus | NA | Non-hemolytic | ||
| 28918200 | 2018 | PHWLFFGVSVLC{ct:Carboxyl (COO-)} | Pep-16 | Carboxyl (COO-) | Free | Linear | L | None | 12 | ND | 0 % Hemolysis at 125 μM | Rat | Scorpion Tityus Obscurus | NA | Non-hemolytic | ||
| 28918200 | 2018 | VTLTLPPAES{ct:Amid} | Pep-17 | Amidation | Free | Linear | L | None | 10 | ND | 0 % Hemolysis at 125 μM | Rat | Scorpion Tityus Obscurus | NA | Non-hemolytic | ||
| 28918200 | 2018 | KETNAKPP{ct:Carboxyl (COO-)} | Pep-18 | Carboxyl (COO-) | Free | Linear | L | None | 8 | ND | 0 % Hemolysis at 125 μM | Rat | Scorpion Tityus Obscurus | NA | Non-hemolytic | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}{nt:H}{ct:Amid} | Peptoid - 1 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 100 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}{nt:H}{ct:Amid} | Peptoid - 2 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 9 | Antibacterial | 38.7 ± 5.4 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl){nt:H}{ct:Amid} | Peptoid - 3 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 100 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3){nt:H}{ct:Amid} | Peptoid - 4 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 100 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF){nt:H}{ct:Amid} | Peptoid - 5 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 100 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}{nt:H}{ct:Amid} | Peptoid - 6 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 13 | Antibacterial | 48.1 ± 3 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}{nt:H}{ct:Amid} | Peptoid - 7 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 10 | Antibacterial | 9.8 ± 0.8 % Hemolysis at 200 mM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | GIGKFLKKAKKFGKAFVKILKK{ct:Amid} | Pexiganan | Amidation | Free | Linear | L | None | 22 | Antimicrobial peptides | 21.5 ± 2.9 % Hemolysis at 200 mM | Rat | Synthetic Peptide Xenopus Laevis Frog | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}{nt:H}{ct:Amid} | Peptoid - 1 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 10 % Hemolysis at 9.1 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}{nt:H}{ct:Amid} | Peptoid - 2 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 9 | Antibacterial | 10 % Hemolysis at 119.5 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl){nt:H}{ct:Amid} | Peptoid - 3 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 10 % Hemolysis at <6.25 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3){nt:H}{ct:Amid} | Peptoid - 4 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 10 % Hemolysis at <6.25 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF){nt:H}{ct:Amid} | Peptoid - 5 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 10 % Hemolysis at <6.25 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}{nt:H}{ct:Amid} | Peptoid - 6 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 13 | Antibacterial | 10 % Hemolysis at 19.5 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}{nt:H}{ct:Amid} | Peptoid - 7 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 10 | Antibacterial | 10 % Hemolysis at >200 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | GIGKFLKKAKKFGKAFVKILKK{ct:Amid} | Pexiganan | Amidation | Free | Linear | L | None | 22 | Antimicrobial peptides | 10 % Hemolysis at 113.4 μM | Rat | Synthetic Peptide Xenopus Laevis Frog | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}{nt:H}{ct:Amid} | Peptoid - 1 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 50 % Hemolysis at 63.4 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}{nt:H}{ct:Amid} | Peptoid - 2 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 9 | Antibacterial | 50 % Hemolysis at 1>200 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl)-{nnr:Nlys}-{nnr:Nspe}(pCl)-{nnr:Nspe}(pCl){nt:H}{ct:Amid} | Peptoid - 3 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 50 % Hemolysis at 10.4 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3)-{nnr:Nlys}-{nnr:Nspe}(pCH3)-{nnr:Nspe}(pCH3){nt:H}{ct:Amid} | Peptoid - 4 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 50 % Hemolysis at 8.3 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF)-{nnr:Nlys}-{nnr:Nspe}(pF)-{nnr:Nspe}(pF){nt:H}{ct:Amid} | Peptoid - 5 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 12 | Antibacterial | 50 % Hemolysis at <6.25 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}{nt:H}{ct:Amid} | Peptoid - 6 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 13 | Antibacterial | 50 % Hemolysis at >200 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | {nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}-{nnr:Nspe}-{nnr:Nspe}-{nnr:Nlys}{nt:H}{ct:Amid} | Peptoid - 7 | Amidation | H | Linear | NA | Nlys = N-(4-aminobutyl)glycine, Nspe = N-(S)-(1-phenylethyl)glycine | 10 | Antibacterial | 50 % Hemolysis at >200 μM | Rat | Synthetic Peptoid | α-Helical | NA | ||
| 29198866 | 2018 | GIGKFLKKAKKFGKAFVKILKK{ct:Amid} | Pexiganan | Amidation | Free | Linear | L | None | 22 | Antimicrobial peptides | 50 % Hemolysis at >200 μM | Rat | Synthetic Peptide Xenopus Laevis Frog | α-Helical | NA | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 2.0 ± 1.4 % Hemolysis at 1 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 2.8 ± 1.3 % Hemolysis at 0.75 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 2.4 ± 1.4 % Hemolysis at 0.5 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 2.6 ± 0.6 % Hemolysis at 0.25 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 3.2 ± 1.1 % Hemolysis at 0.125 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 2.3 ± 0.6 % Hemolysis at 0.05 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 1.8 ± 1.6 % Hemolysis at 0.025 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 0.5 ± 0.5 % Hemolysis at 0.0125 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29402952 | 2018 | MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASPKKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK | histone H5 | Free | Free | Linear | L | None | 190 | Antimicrobial | 0.1 ± 0.4 % Hemolysis at 0.005 mg/mL | Rat | Chicken Erythrocytes | Random Coil in aq | Non-hemolytic | ||
| 29682907 | 2018 | ACPIFTKIQGTYRGKAKCK{ct:myristoylated} | MPhd1 | myristoylated | Free | Linear | L | Myr = Myristic acid | 19 | Antibacterial | >70 % Hemolysis at 10 μM | Rat | Human-Β-Defensins | buffer = β-conformation | NA | ||
| 29682907 | 2018 | FCPRRYKQIGTGLPGTKCK{ct:myristoylated} | MPhd2 | myristoylated | Free | Linear | L | Myr = Myristic acid | 19 | Antibacterial | >20 % Hemolysis at 10 μM | Rat | Human-Β-Defensins | buffer = unordered conformation | NA | ||
| 29682907 | 2018 | SCLPKEEQIGKSTRGRKCRRKK{ct:myristoylated} | MPhd3 | myristoylated | Free | Linear | L | Myr = Myristic acid | 22 | Antimicrobial, Antibacterial | >40 % Hemolysis at 10 μM | Rat | Human-Β-Defensins | buffer = unordered conformation | NA | ||
| 30717183 | 2019 | GMWSKILGHLIR | HAL-1 | Free | Free | Linear | L | None | 12 | Antimicrobial | 50 % Hemolysis at 82 µM | Rat | Eusocial Bee Venom Halictus Sexcinctus | 30% TFE = α-Helix | NA | ||
| 30717183 | 2019 | GMWSKILGPLIR | HAL-1/2 | Free | Free | Linear | L | None | 12 | Antimicrobial | 50 % Hemolysis at >200 µM | Rat | Analogs Of Hal-1 | 30% TFE = α-Helix | NA | ||
| 30717183 | 2019 | GMWSKILGHLIK | HAL-1/6 | Free | Free | Linear | L | None | 12 | Antimicrobial | 50 % Hemolysis at 132 µM | Rat | Analogs Of Hal-1 | 30% TFE = α-Helix | NA | ||
| 30717183 | 2019 | GMWKKILGKLIR | HAL-1/10 | Free | Free | Linear | L | None | 12 | Antimicrobial | 50 % Hemolysis at >200 µM | Rat | Analogs Of Hal-1 | 30% TFE = α-Helix | NA | ||
| 30717183 | 2019 | GKWSKILGKLIR | HAL-1/20 | Free | Free | Linear | L | None | 12 | Antimicrobial | 50 % Hemolysis at >200 µM | Rat | Analogs Of Hal-1 | 30% TFE = α-Helix | NA | ||
| 31359624 | 2019 | GIIAGIIIKIKK{ct:Amid} | zp3 | Amidation | Free | Linear | L | None | 12 | Antibacterial | <5 % Hemolysis at 256 μM | Rat | Derived From Phenol-Soluble Modulins (Psms) Virulent Staphylococcus Aureus Strains | water = Random coil, SDS = α-Helix | Low hemolytic | ||
| 32258871 | 2020 | ACPIFTKIQGTYRGKAKCK | Phd1 | Free | Free | Linear | L | None | 19 | Antibacterial | >12.5 % Hemolysis at 5 μM | Rat | Human-Β-Defensins Hbd1 Analogues | NA | NA | ||
| 32258871 | 2020 | SCLPKEEQIGKSTRGRKCRRKK | Phd3 | Free | Free | Linear | L | None | 22 | Antibacterial | >12.5 % Hemolysis at 12 μM | Rat | Human-Β-Defensins Hbd3 Analogues | NA | NA | ||
| 32258871 | 2020 | ACPIFTKIQGTYRGKAKCK{nt:Myr = myristoylated} | MPhd1 | Free | Myr = myristoylated | Linear | L | None | 19 | Antibacterial | >80 % Hemolysis at 5 μM | Rat | Myristoylated Mphd1 | NA | NA | ||
| 32258871 | 2020 | SCLPKEEQIGKSTRGRKCRRKK{nt:Myr = myristoylated} | MPhd3 | Free | Myr = myristoylated | Linear | L | None | 22 | Antibacterial | >50 % Hemolysis at 12 μM | Rat | Myristoylated Mphd3 | NA | NA | ||
| 32242658 | 2020 | RRRRRRRRRRRR | R12 | Free | Free | Linear | L | None | 12 | Antibacterial | 5 % Hemolysis at >4000 μg/mL | Rat | Arginine-Based Four-Armed Copolypeptides | NA | Non-hemolytic | ||
| 32242658 | 2020 | RRRRRRRRRRRRKKK{ct:Amid} | 4R3 | Amidation | Free | Linear | L | None | 15 | Antibacterial | 5 % Hemolysis at >4000 μg/mL | Rat | Arginine-Based Four-Armed Copolypeptides | NA | Non-hemolytic | ||
| 32242658 | 2020 | RRRRRRRRRRRRRRRRRRRRRRRRKKK{ct:Amid} | 4R6 | Amidation | Free | Linear | L | None | 27 | Antibacterial | 5 % Hemolysis at >4000 μg/mL | Rat | Arginine-Based Four-Armed Copolypeptides | NA | Non-hemolytic | ||
| 32242658 | 2020 | RGRGRGRGRGRGRGRGRGRGRGRGKKK{ct:Amid} | 4R3G3 | Amidation | Free | Linear | L | None | 27 | Antibacterial | 5 % Hemolysis at >4000 μg/mL | Rat | Arginine-Based Four-Armed Copolypeptides | NA | Non-hemolytic | ||
| 32242658 | 2020 | RGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGKKK{ct:Amid} | 4R6G6 | Amidation | Free | Linear | L | None | 51 | Antibacterial | 5 % Hemolysis at >4000 μg/mL | Rat | Arginine-Based Four-Armed Copolypeptides | NA | Non-hemolytic | ||
| 32229648 | 2020 | AHFLPPIIRA{ct:Amid} | Dq-1133 | Amidation | Free | Linear | L | None | 10 | NA | 0 % Hemolysis at 10 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | Non-hemolytic | ||
| 32229648 | 2020 | GVIPDDFRIR | Dq-1187 | Free | Free | Linear | L | None | 10 | NA | 0 % Hemolysis at 10 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | Non-hemolytic | ||
| 32229648 | 2020 | LVGALVSTLLSLVPSLMK{ct:Amid} | Dq-1840 | Amidation | Free | Linear | L | None | 18 | Antibacterial | 7.8 % Hemolysis at 10 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | NA | ||
| 32229648 | 2020 | FWGTLAKWALKAIPAAMGMKQNK | Dq-2562 | Free | Free | Linear | L | None | 23 | Antibacterial, Antifungal, histamine-releasing | 5.1 % Hemolysis at 10 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | NA | ||
| 32229648 | 2020 | GLKDWWNKHKDKIVKVVKEMGKAGINAA{ct:Amid} | Dq-3162 | Amidation | Free | Linear | L | None | 28 | Antibacterial, Antifungal, histamine-releasing | 0 % Hemolysis at 10 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | Non-hemolytic | ||
| 32229648 | 2020 | AHFLPPIIRA{ct:Amid} | Dq-1133 | Amidation | Free | Linear | L | None | 10 | NA | 1.5 % Hemolysis at 50 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | Non-hemolytic | ||
| 32229648 | 2020 | GVIPDDFRIR | Dq-1187 | Free | Free | Linear | L | None | 10 | NA | 0.3 % Hemolysis at 50 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | Non-hemolytic | ||
| 32229648 | 2020 | LVGALVSTLLSLVPSLMK{ct:Amid} | Dq-1840 | Amidation | Free | Linear | L | None | 18 | Antibacterial | 35.3 % Hemolysis at 50 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | NA | ||
| 32229648 | 2020 | FWGTLAKWALKAIPAAMGMKQNK | Dq-2562 | Free | Free | Linear | L | None | 23 | Antibacterial, Antifungal, histamine-releasing | 82.9 % Hemolysis at 50 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | NA | ||
| 32229648 | 2020 | GLKDWWNKHKDKIVKVVKEMGKAGINAA{ct:Amid} | Dq-3162 | Amidation | Free | Linear | L | None | 28 | Antibacterial, Antifungal, histamine-releasing | 5.6 % Hemolysis at 50 μM | Rat | Giant Ant Dinoponera Quadriceps | NA | NA | ||
| 32764602 | 2020 | K-K-L-K-{nnr:(2-Nal)Ala}-F-{nnr:(2-Nal-)Ala} | 1 | Free | Free | Linear | L | (2-Nal)Ala = 2-napthylalanine | 7 | Antibacterial, Anticancer | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | {nnr:(N1-Nal)Gly}-{nnr:(N-Phe)Gly}-{nnr:(N1-Nal)Gly}-{nnr:(N-Bu)Gly}-K-K-K | 2 | Free | Free | Linear | L | (N-Phe)Gly = N-benzylglycine, (N1-Nal)Gly = N-1-naphthylmethylglycine, (N-Bu)Gly = N-butylglycine | 7 | Antibacterial, Anticancer | 100 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | {nnr:(2-nal)ala}-F{d}-{nnr:(2-nal)ala}-K-L{d}-K-K | 3 | Free | Free | Linear | Mix | (2-nal)ala = D-2-napthylalanin, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | {nnr:(2-nal)ala}-F{d}-{nnr:(2-nal)ala}-L{d}-K-K-K | 4 | Free | Free | Linear | Mix | (2-nal)ala = D-2-napthylalanin, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial, Anticancer | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | {nnr:(1-Nal)Ala}-F-{nnr:(1-Nal)Ala}-L-K-K-K | 5 | Free | Free | Linear | L | (1-Nal)Ala = 1-napthylalanine | 7 | Antibacterial, Anticancer | 10.2 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-L-K-{nnr:(1-Nal)Ala}-F-{nnr:(1-Nal)Ala} | 6 | Free | Free | Linear | L | (1-Nal)Ala = 1-napthylalanine | 7 | Antibacterial | 18.2 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-L-{nnr:(1-Nal)Ala}-F{nnr:(1-Nal)Ala} | 7 | Free | Free | Linear | L | (1-Nal)Ala = 1-napthylalanine | 7 | Antibacterial | 54.3 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | {nnr:(1-nal)ala}-F{d}-{nnr:(1-nal)ala}-K-L{d}-K-K | 8 | Free | Free | Linear | Mix | (1-nal)ala = D-1-napthylalanine, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | {nnr:(1-nal)ala}-F{d}-{nnr:(1-nal)ala}-L{d}-K-K-K | 9 | Free | Free | Linear | Mix | (1-nal)ala = D-1-napthylalanine, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | K-K-L{d}-K-{nnr:(1-nal)ala}-F{d}-{nnr:(1-nal)ala} | 10 | Free | Free | Linear | Mix | (1-nal)ala = D-1-napthylalanine, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-L{d}-{nnr:(1-nal)ala}-F{d}-{nnr:(1-nal)ala} | 11 | Free | Free | Linear | Mix | (1-nal)ala = D-1-napthylalanine, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial, Anticancer | 11.3 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-L{d}-{nnr:(2-nal)ala}-F{d}-{nnr:(2-nal)ala} | 12 | Free | Free | Linear | Mix | (2-nal)ala = D-2-napthylalanin, f = D-phenylalanine, l = D-Leu | 7 | Antibacterial | 17.9 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | {nnr:(2-Nal)Ala}-F-{nnr:(2-Nal)Ala}-K-L-K-K | 13 | Free | Free | Linear | L | (2-Nal)Ala = 2-napthylalanine | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | K-K-{nnr:(N-Bu)Gly}-K-{nnr:(N1-Nal)Gly}-{nnr:(N-Phe)Gly}-{nnr:(N1-Nal)Gly} | 14 | Free | Free | Linear | L | (N-Bu)Gly = N-butylglycine, (N1-Nal)Gly = N-1-napthylmethylglycine, (N-Phe)Gly = N-benyzylglycine | 7 | Antibacterial | 31.6 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-{nnr:(N-Bu)Gly}-{nnr:(N1-Nal)Gly}-{nnr:(N-Phe)Gly}-{nnr:(N1-Nal)Gly} | 15 | Free | Free | Linear | L | (N-Bu)Gly = N-butylglycine, (N1-Nal)Gly = N-1-napthylmethylglycine, (N-Phe)Gly = N-benyzylglycine | 7 | Antibacterial, Anticancer | 99.5 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | {nnr:(1-Nal)Ala}-F-{nnr:(1-Nal)Ala}-K-L-K-K | 16 | Free | Free | Linear | L | (1-Nal)Ala = 1-napthylalanine | 7 | Antibacterial | 11 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-L-{nnr:(2-Nal)Ala}-Y-{nnr:(2-Nal)Ala} | 17 | Free | Free | Linear | L | (2-Nal)Ala = 2-napthylalanine | 7 | Antibacterial | 100.1 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-{nnr:Nle}-{nnr:(2-Nal)Ala}-F-{nnr:(2-Nal)Ala} | 18 | Free | Free | Linear | L | (2-Nal)Ala = 2-napthylalanine, Nle= norleucine | 7 | Antibacterial | 98.6 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-Leu{nnr:(1-Nal)Ala}-Y-{nnr:(1-Nal)Ala} | 19 | Free | Free | Linear | L | (1-Nal)Ala = 1-napthylalanine | 7 | Antibacterial | 100.6 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | K-K-K-{nnr:Nle}-{nnr:(1-Nal)Ala}-F-{nnr:(1-Nal)Ala} | 20 | Free | Free | Linear | L | (1-Nal)Ala = 1-napthylalanine, Nle= norleucine | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | K-K-K-l--{nnr:(1-nal)ala}-Y{d}-{nnr:(1-nal)ala} | 21 | Free | Free | Linear | Mix | (1-nal)ala = D-1-napthylalanine, y = D-Tyr | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | K-K-K-{nnr:Nle}-{nnr:(2-Nal)Ala}-Y-{nnr:(2-Nal)Ala} | 22 | Free | Free | Linear | L | (2-Nal)Ala = 2-napthylalanine, Nle= norleucine | 7 | Antibacterial | 24.2 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | NA | ||
| 32764602 | 2020 | {nnr:N-Lys}-{nnr:N-Lys}-{nnr:N-Lys}-L-{nnr:(2-Nal)Ala}-F-{nnr:(2-Nal)Ala} | 23 | Free | Free | Linear | L | N-Lys = N-(4-aminobutyl)glycine, (2-Nal)Ala = 2-napthylalanine | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 32764602 | 2020 | K-K-K-L{d}-{nnr:(2-nal)ala}-Y{d}-{nnr:(2-nal)ala} | 24 | Free | Free | Linear | Mix | (2-nal)ala = D-2-napthylalanine, y = D-Tyr, l = D-Leu | 7 | Antibacterial | <8 % Hemolysis at 150 µM | Rat | Synthetic Amps | NA | Low hemolytic | ||
| 33236874 | 2020 | FKRLKKLISWIKRKRQQC{ct:Amid} | HnMc | Amidation | Free | Linear | L | None | 18 | Antibacterial | ≥10 % Hemolysis at 1 mg/mL | Rat | Analogue Helicobacter Pylori Ribosomal Protein L1 (Hpa3Nt3) | NA | Low hemolytic | ||
| 34220763 | 2021 | WKKLKKLLKKLKKL{nt:Acet}{ct:Amid} | pepD2 | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial, Antibiofilm | 9.6 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | WKKLKKLLKKL{nt:Acet}{ct:Amid} | pepD3 | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial, Antibiofilm | 3.15 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | PE/PG liposomes = α-Helical | Low hemolytic | ||
| 34220763 | 2021 | WKKVKKVVKKVKKV{nt:Acet}{ct:Amid} | pepV2 | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial, Antibiofilm | 0.31 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Non-hemolytic | ||
| 34220763 | 2021 | WKKIKKIIKKIKKI{nt:Acet}{ct:Amid} | pepI2 | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial, Antibiofilm | 0.27 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Non-hemolytic | ||
| 34220763 | 2021 | WRRLRRLLRRLRRL{nt:Acet}{ct:Amid} | pepR2 | Amidation | Acetylation | Linear | L | None | 14 | Antibacterial, Antibiofilm | 105.65 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | W{nnr:O}{nnr:O}L{nnr:O}{nnr:O}LL{nnr:O}{nnr:O}L{nnr:O}{nnr:O}L{nt:Acet}{ct:Amid} | pepO2 | Amidation | Acetylation | Linear | L | O = L-Ornithine | 14 | Antibacterial, Antibiofilm | 0.23 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Non-hemolytic | ||
| 34220763 | 2021 | WK{d}K{d}L{d}K{d}K{d}L{d}L{d}K{d}K{d}L{d}K{d}K{d}L{d}{nt:Acet}{ct:Amid} | pepdD2 | Amidation | Acetylation | Linear | Mix | None | 14 | Antibacterial, Antibiofilm | 2.9 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | MY{d}R{d}-WKKLKKLLKKLKKL{nt:Myr = myristyl}{ct:Amid} | pepD2M | Amidation | Myr = myristyl | Linear | L | None | 14 | Antibacterial, Antibiofilm | 93.63 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | PA{d}L{d}-WKKLKKLLKKLKKL{nt:Pal = palmitoyl}{ct:Amid} | pepD2P | Amidation | Pal = palmitoyl | Linear | L | None | 14 | Antibacterial, Antibiofilm | 83.45 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | ST{d}E{d}-WKKLKKLLKKLKKL{nt:Ste = stearyl}{ct:Amid} | pepD2S | Amidation | Ste = stearyl | Linear | L | None | 14 | Antibacterial, Antibiofilm | 60.7 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | OC{d}T{d}-WKKLKKLLKKL{nt:Oct = octanoyl}{ct:Amid} | pepD3O | Amidation | Oct = octanoyl | Linear | L | None | 11 | Antibacterial, Antibiofilm | 86.03 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | HE{d}X{d}-WKKLKKLLKKL{nt:Hex = hexanoyl}{ct:Amid} | pepD3H | Amidation | Hex = hexanoyl | Linear | L | None | 11 | Antibacterial, Antibiofilm | 54.07 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 34220763 | 2021 | BU{d}T{d}-WKKLKKLLKKL{nt:But = butanoyl}{ct:Amid} | pepD3B | Amidation | But = butanoyl | Linear | L | None | 11 | Antibacterial, Antibiofilm | 7.89 % Hemolysis at 256 μg/mL | Rat | De Novo Designed Peptide | NA | Low hemolytic | ||
| 36769243 | 2023 | MNLVDRAILIRKRRRAALQLRDKVLRYLK | AMP 1 | Free | Free | Linear | L | None | 29 | Antibacterial | 12.9 ± 1.7 % Hemolysis at 100 µM | Rat | Synthetic Peptide | NA | NA | ||
| 36769243 | 2023 | MKRKKKILIKKVLKLKSSAY | AMP 2 | Free | Free | Linear | L | None | 20 | Antibacterial | 5.2 ± 1.9 % Hemolysis at 100 µM | Rat | Synthetic Peptide | NA | NA | ||
| 36769243 | 2023 | MTDGRYLIKRVKKKKKAVLQLILKFL | AMP 3 | Free | Free | Linear | L | None | 26 | Antibacterial | 29.5 ± 8.2 % Hemolysis at 100 µM | Rat | Synthetic Peptide | NA | NA | ||
| 36145681 | 2022 | GFLFKLIPKAIKKLISKFK | GK-19 | Free | Free | Linear | L | None | 19 | Antibacterial, Antifungal | <5 % Hemolysis at 100 μM | Rat | Synthetic | NA | Low hemolytic | ||
| 36145681 | 2022 | GFLFKLIPKAIKKLISKFK | GK-19 | Free | Free | Linear | L | None | 19 | Antibacterial, Antifungal | 15 % Hemolysis at 200 μM | Rat | Synthetic | NA | Low hemolytic | ||
| 36145681 | 2022 | GFLFKLIPKAIKKLISKFK | GK-19 | Free | Free | Linear | L | None | 19 | Antibacterial, Antifungal | 40 % Hemolysis at 400 μM | Rat | Synthetic | NA | Low hemolytic | ||
| 19113844 | 2009 | GLWSKIKEVGKEAAKAAAKAAGK | Dermaseptin B2 (1-23) | Free | Free | Linear | L | None | 23 | Antibacterial | 0 % Hemolysis at 50μM | Rat | Synthetic Construct | NA | Non-hemolytic | ||
| 17761205 | 2007 | MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEGIKL | Phospholipase A1 (PLA1) (EC 3.1.1.32) (allergen Poly p 1) | Free | Free | Linear | L | None | 322 | Allergic | 17±4 % Hemolytic at 100µM | Rat | Polybia Paulista (Neotropical Social Wasp) (Swarm-Founding Polistine Wasp) | NA | NA | ||
| 22100226 | 2011 | VNWKKILGKIIKVVK{nt:H}{ct:Amid} | Lasioglossin-3 (LL-III) | Amidation | H | Linear | L | None | 15 | Antimicrobial | 50 % Hemolytic at >200µM | Rat | Lasioglossum Laticeps (Bee) | Alphα-Helix | Low hemolytic | ||
| 19591185 | 2009 | VNWKKVLGKIIKVAK{ct:Amid} | Lasioglossin-1 (LL-I) | Amidation | Free | Linear | L | None | 15 | Antimicrobial | >200 % Hemolytic at 50µM | Rat | Lasioglossum Laticeps (Bee) | Alpha Helix | Non-hemolytic | ||
| 19591185 | 2009 | VNWKKILGKIIKVAK{ct:Amid} | Lasioglossin-2 (LL-II) | Amidation | Free | Linear | L | None | 15 | Antimicrobial | >200 % Hemolytic at 50µM | Rat | Lasioglossum Laticeps (Bee) | Alpha Helix | Non-hemolytic | ||
| 25017240 | 2014 | MKNYSKNATYLITVLLFSFVTMLLIIPSKCEAVSNDMQPLEARTADLVQQPRYIIDVPPRCPPGSKFVHKRCRVIVP{ct:Amid} | Secapin-2 | Amidation | Free | Linear | L | None | 77 | Antimicrobial | Hemolytic | Rat | Apis Mellifera (Honeybee) | Helical,Strand and unordered | Non-hemolytic | ||
| 15222751 | 2004 | MAFLKKSLFLVLFLALVPLSICEAEKREEENEEKQEDDDESEKKRGVVTDLLNTAGGLLGNLVGSLSGGER{ct:Amid} | Plasticin-DA1 (PTC-DA1) (Dermaseptin PD-3-6) (DRP-PD3-6) (PD36) | Amidation | Free | Linear | L | None | 71 | Antimicrobial | 65 % Hemolytic at 100µM | Rat | Agalychnis Dacnicolor (Giant Mexican Leaf Frog) (Pachymedusa Dacnicolor) | Helix | NA | ||
| 16401077 | 2005 | GLRSKIWLWVLLMIWQESNKFKKM | Atypical cationic antimicrobial peptide (Dermaseptin-S9) (DRS-S9) | Free | Free | Linear | L | None | 24 | Antimicrobial | 50 % Hemolytic at 175µM | Rat | Phyllomedusa Sauvagei (Sauvage'S Leaf Frog) | Alphα-Helical | NA |