Please wait...
| ID | PMID | YEAR | Sequence | MAP | Name | C-ter MOD | N-ter MOD | Linear/Cyclic | Stereo-Chemistry | Modified | Length | Fuction | Activity | RBCs Source | Origin | Experimental structure | Non-Hemolytic |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 17658606 | 2007 | DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR | pBD-2 | Free | Free | Linear | L | None | 37 | Antimicrobial | 50% hemolysis at 128µg/ml | Porcine | Porcine defensin | NA | NA | ||
| 17658606 | 2007 | DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR | pBD-2 | Free | Free | Linear | L | None | 37 | Antimicrobial | 10% hemolysis at 64µg/ml | Porcine | Porcine defensin | NA | NA | ||
| 23220638 | 2013 | KNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK | pBD142 | Free | Free | Linear | L | None | 42 | Antimicrobial | <11% hemolytic from 0–100μg/mL | Porcine | Porcine beta defensin 1 (Pigs) | NA | NA | ||
| 22670762 | 2013 | GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT | OG1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 80% hemolytic at 256 μg/mL | Porcine | Palustrin-OG1 ( Odorrana grahami) | NA | NA | ||
| 22670762 | 2013 | GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT | OG1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 10% hemolytic at 4 μg/mL | Porcine | Palustrin-OG1 ( Odorrana grahami) | NA | NA | ||
| 22670762 | 2013 | KKFFLKVLTKIRCKVAGGCRT | OG2 | Free | Free | Linear | L | None | 21 | Antimicrobial | 10% hemolytic at 256 μg/mL | Porcine | Variant of OG1 | NA | NA | ||
| 22973850 | 2013 | DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR | pBD2 | Free | Free | Linear | L | None | 37 | Antimicrobial | 12% hemolysis at 80μg/ml | Porcine | Synthetic peptide | α-helical | NA | ||
| 8577744 | 1996 | GSKKPVPIIYCNRRTGKCQRM | Thanatin | Free | Free | Linear | L | None | 21 | Antimicrobial | 0% hemolysis at 40μM | Porcine | Synthetic Peptide | NA | Non-hemolytic | ||
| 29135962 | 2017 | HSDAVFTDNYTRLRKQMAVKKYLNSILN | VIP 1(vasoactive intestinal peptide) | Free | Free | Linear | L | None | 28 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Host-Defence Peptide | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | HSKAVFTKNYTRLRKQMAVKKYLNSILN | VIP 2 | Free | Free | Linear | L | None | 28 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | HSDAVFTDNSTRLRKQMAVKKSLNSILN | VIP 3 | Free | Free | Linear | L | None | 28 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | HSDAVFTDNYTRLRKQMAVKKYLNSILT | VIP 4 | Free | Free | Linear | L | None | 28 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | HSKAVFTKNYTRLRKQMAVKKYLNSILT | VIP 5 | Free | Free | Linear | L | None | 28 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | HSDAVFTDNSTRLRKQMAVKKSLNSILT | VIP 6 | Free | Free | Linear | L | None | 28 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | HSDAVFTANYTRLRRQLAVRRYLAAILGRR | VIP 7 | Free | Free | Linear | L | None | 30 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | FTANYTRLRRQLAVRRYLAAILGRR | VIP 8 | Free | Free | Linear | L | None | 26 | Antimicrobial | 0 % Hemolysis at <19.2 µM | Porcine | Vip Analogues | α-Helical | Non-hemolytic | ||
| 29135962 | 2017 | FTANYTRLRRQLAVRRYLAAILGRR | VIP 8 | Free | Free | Linear | L | None | 26 | Antimicrobial | 1.12 % Hemolysis at 76.8 µM | Porcine | Vip Analogues | α-Helical | NA | ||
| 30886247 | 2019 | [LL-37, 37 aa] | LL-37 | Free | Free | Linear | L | None | 37 | Antibacterial | 30 % Hemolysis at 40 µM | Porcine | Human | α-Helix | NA | ||
| 30886247 | 2019 | RFGRFLRKIRRFRPKVTITIQGSARF{ct:Amid} | CATH-2 | Amidation | Free | Linear | L | None | 26 | Antibacterial, Antifungal | <10 % Hemolysis at 40 µM | Porcine | Chicken | α-Helix and α-Helix | NA | ||
| 30886247 | 2019 | GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG{nt:Acet} | PMAP-36 | Free | Acetylation | Linear | L | None | 36 | Antibacterial | <10 % Hemolysis at 40 µM | Porcine | Porcine Cathelicidin | α-Helix | NA | ||
| 30973929 | 2019 | EVL{d}ADL{d}V{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP1 | Amidation | Palmityl | Cyclic | Mix | None | 7 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 40 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EVL{d}DL{d}V{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP2 | Amidation | Palmityl | Cyclic | Mix | None | 6 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 100 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EVL{d}DL{d}{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP3 | Amidation | Palmityl | Cyclic | Mix | None | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 80 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EVL{d}L{d}{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP4 | Amidation | Palmityl | Cyclic | Mix | None | 4 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 5 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | Low hemolytic | ||
| 30973929 | 2019 | EVL{d}DL{d}{nt:Palmityl}{ct:Amid} | SLP5 | Amidation | Palmityl | Linear | Mix | None | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 25 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | KVL{d}KL{d}{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP6 | Amidation | Palmityl | Cyclic | Mix | None | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 90 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EVLDL{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP7 | Amidation | Palmityl | Cyclic | L | None | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 30 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EVL{d}L{d}D{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP8 | Amidation | Palmityl | Cyclic | Mix | None | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 100 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EDVL{d}L{d}{cyc:N-C}{nt:Palmityl}{ct:Amid} | SLP9 | Amidation | Palmityl | Cyclic | Mix | None | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 50 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 30973929 | 2019 | EVlDl{cyc:N-C}{nt:Heptaalkyl-biphenyl-acid}{ct:Amid} | SLP10 | Amidation | Heptaalkyl-biphenyl-acid | Cyclic | Mix | Heptaalkyl-biphenyl-acid | 5 | Anti-viral, Anti-PEDV(Porcine epidemic diarrhea virus) | 55 % Hemolysis at 10 μg/mL | Porcine | Synthetic Surfactin Lipopeptide Analogues | NA | NA | ||
| 32770019 | 2020 | QNLCNIYYIQHADHCLAVINS | AtR100 | Free | Free | Linear | L | None | 21 | Antibacterial, Antifungal | 0.49 % Hemolysis at 125 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | QNLCNIYYIQHADHCLAVINS | AtR100 | Free | Free | Linear | L | None | 21 | Antibacterial, Antifungal | 0.98 % Hemolysis at 250 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | QNLCNIYYIQHADHCLAVINS | AtR100 | Free | Free | Linear | L | None | 21 | Antibacterial, Antifungal | 1.35 % Hemolysis at 500 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | QNLCNIYYIQHADHCLAVINS | AtR100 | Free | Free | Linear | L | None | 21 | Antibacterial, Antifungal | 2.09 % Hemolysis at 1000 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | LCVSYSVRPSCKFVGRSNWKRNTCLEWCDQLFLFCFLIGGEMANS | AtR472 | Free | Free | Linear | L | None | 45 | Antibacterial, Antifungal | 0.73 % Hemolysis at 125 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | LCVSYSVRPSCKFVGRSNWKRNTCLEWCDQLFLFCFLIGGEMANS | AtR472 | Free | Free | Linear | L | None | 45 | Antibacterial, Antifungal | 1.11 % Hemolysis at 250 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | LCVSYSVRPSCKFVGRSNWKRNTCLEWCDQLFLFCFLIGGEMANS | AtR472 | Free | Free | Linear | L | None | 45 | Antibacterial, Antifungal | 1.35 % Hemolysis at 500 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 32770019 | 2020 | LCVSYSVRPSCKFVGRSNWKRNTCLEWCDQLFLFCFLIGGEMANS | AtR472 | Free | Free | Linear | L | None | 45 | Antibacterial, Antifungal | 1.97 % Hemolysis at 1000 µg/ml | Porcine | Plant Aegilops Tauschii Cosson | α-Helix β-Strand | Non-hemolytic | ||
| 35563004 | 2022 | LAVHHLHSIRGRHHSCTIAQTQANHRHNSYQPNNSSCLAKETDLPTTRSTPATTSSTAPARKSPPASPAPTRQRLCPSPPRGPVSSRHPRRRGQARGRTRAAGVRRTKGYGGKCV | CgR2150 | Free | Free | Linear | L | None | 115 | Antibacterial | ∼0 % Hemolysis at 10 µg/mL | Porcine | Bacillus Subtilis | α-Helix Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVHHLHSIRGRHHSCTIAQTQANHRHNSYQPNNSSCLAKETDLPTTRSTPATTSSTAPARKSPPASPAPTRQRLCPSPPRGPVSSRHPRRRGQARGRTRAAGVRRTKGYGGKCV | CgR2150 | Free | Free | Linear | L | None | 115 | Antibacterial | ∼0 % Hemolysis at 20 µg/mL | Porcine | Bacillus Subtilis | α-Helix Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVHHLHSIRGRHHSCTIAQTQANHRHNSYQPNNSSCLAKETDLPTTRSTPATTSSTAPARKSPPASPAPTRQRLCPSPPRGPVSSRHPRRRGQARGRTRAAGVRRTKGYGGKCV | CgR2150 | Free | Free | Linear | L | None | 115 | Antibacterial | ∼0 % Hemolysis at 30 µg/mL | Porcine | Bacillus Subtilis | α-Helix Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVHHLHSIRGRHHSCTIAQTQANHRHNSYQPNNSSCLAKETDLPTTRSTPATTSSTAPARKSPPASPAPTRQRLCPSPPRGPVSSRHPRRRGQARGRTRAAGVRRTKGYGGKCV | CgR2150 | Free | Free | Linear | L | None | 115 | Antibacterial | ∼0 % Hemolysis at 40 µg/mL | Porcine | Bacillus Subtilis | α-Helix Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVHHLHSIRGRHHSCTIAQTQANHRHNSYQPNNSSCLAKETDLPTTRSTPATTSSTAPARKSPPASPAPTRQRLCPSPPRGPVSSRHPRRRGQARGRTRAAGVRRTKGYGGKCV | CgR2150 | Free | Free | Linear | L | None | 115 | Antibacterial | 0.32 % Hemolysis at 50 µg/mL | Porcine | Bacillus Subtilis | α-Helix Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVPNFEPPTRTTCPAPTSPGNPCGPPPPASQTRRPPFHPTSPLRR | CgR3101 | Free | Free | Linear | L | None | 46 | Antibacterial | ∼0 % Hemolysis at 10 µg/mL | Porcine | Bacillus Subtilis | Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVPNFEPPTRTTCPAPTSPGNPCGPPPPASQTRRPPFHPTSPLRR | CgR3101 | Free | Free | Linear | L | None | 46 | Antibacterial | ∼0 % Hemolysis at 20 µg/mL | Porcine | Bacillus Subtilis | Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVPNFEPPTRTTCPAPTSPGNPCGPPPPASQTRRPPFHPTSPLRR | CgR3101 | Free | Free | Linear | L | None | 46 | Antibacterial | ∼0 % Hemolysis at 30 µg/mL | Porcine | Bacillus Subtilis | Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVPNFEPPTRTTCPAPTSPGNPCGPPPPASQTRRPPFHPTSPLRR | CgR3101 | Free | Free | Linear | L | None | 46 | Antibacterial | ∼0 % Hemolysis at 40 µg/mL | Porcine | Bacillus Subtilis | Random coil | Low hemolytic | ||
| 35563004 | 2022 | LAVPNFEPPTRTTCPAPTSPGNPCGPPPPASQTRRPPFHPTSPLRR | CgR3101 | Free | Free | Linear | L | None | 46 | Antibacterial | 0.46 % Hemolysis at 50 µg/mL | Porcine | Bacillus Subtilis | Random coil | Low hemolytic | ||
| 27915018 | 2017 | WWWLKRIW{ct:Amid} | TetraF2W-KR | Amidation | Free | Linear | L | None | 8 | Antibacterial, Antifungal, candidacidal, Anti-MRSA, Hemolytic | 50 % Hemolytic at 50µM | Porcine | Synthetic Peptide | Rich | NA | ||
| 27915018 | 2017 | WWWLRKIW{ct:Amid} | TetraF2W-RK | Amidation | Free | Linear | L | None | 8 | Antibacterial, Antifungal, candidacidal, Anti-MRSA, Hemolytic | 50 % Hemolytic at 40µM | Porcine | Synthetic Peptide | Helix | NA | ||
| 27915018 | 2017 | WWWLKKIW{ct:Amid} | TetraF2W-KK | Amidation | Free | Linear | L | None | 8 | Antibacterial, Antifungal, candidacidal, Anti-MRSA, Hemolytic | 50 % Hemolytic at 55µM | Porcine | Synthetic Peptide | Rich | NA | ||
| 38988311 | 2024 | HLLSLLKKAAKKLLKKLLKKLAKKL | DeNo1011 | Free | Free | Linear | L | None | 25 | Antibacterial Gram-, Hemolytic | 50 % Hemolytic at 32µg/ml | Porcine | Synthetic Peptide | NA | NA | ||
| 38988311 | 2024 | KIFGKILKKLLKKLLKKLLKKL | DeNo1013 | Free | Free | Linear | L | None | 22 | Antibacterial Gram-, Hemolytic | 50 % Hemolytic at 64µg/ml | Porcine | Synthetic Peptide | NA | NA | ||
| 38988311 | 2024 | FLPIIAGLAAKLLPKLFCKITKKC | DeNo1017 | Free | Free | Linear | L | None | 24 | Antibacterial, Hemolytic | 50 % Hemolytic at 16µg/ml | Porcine | Synthetic Peptide | NA | NA | ||
| 38988311 | 2024 | FLPIIAGLAAKFLPKIFCKITKKC | DeNo1016 | Free | Free | Linear | L | None | 24 | Antibacterial, Hemolytic | 50 % Hemolytic at 4-8 µg/ml | Porcine | Synthetic Peptide | NA | NA |