Please wait...
| ID | PMID | YEAR | Sequence | MAP | Name | C-ter MOD | N-ter MOD | Linear/Cyclic | Stereo-Chemistry | Modified | Length | Fuction | Activity | RBCs Source | Origin | Experimental structure | Non-Hemolytic |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 17462733 | 2007 | RLKELITTGGQKIGEKIRRIGQRIKDFFKNLQPREEKS | K9CATH | Free | Free | Linear | L | None | 38 | Antimicrobial | 20% hemolysis at 100 μM | Chicken | K9CATH canine cathelicidin present in neutorphil granule content | α-helix | NA | ||
| 19524300 | 2009 | RFGRFLRKIRRFRPKVTITIQGSARFG | C1-27 | Free | Free | Linear | L | None | 27 | Immunomodulatory and antimicrobial | 50% hemolysis at 40μM | Chicken | Host defense peptide cathelicidin-2 (CATH-2) analog (Chicken ) | Helical | NA | ||
| 19524300 | 2009 | RFGRFLRKIRRFRPKVTITIQGSARF{ct:Amid} | C1-26 | Amidation | Free | Linear | L | None | 26 | Immunomodulatory and antimicrobial | 60% hemolysis at 40μM | Chicken | Host defense peptide cathelicidin-2 (CATH-2) analog (Chicken ) | Helical | NA | ||
| 19524300 | 2009 | RFGRFLRKIRRFRPKVTITIQ | C1-21 | Free | Free | Linear | L | None | 21 | Immunomodulatory and antimicrobial | 40% hemolysis at 40μM | Chicken | Host defense peptide cathelicidin-2 (CATH-2) analog (Chicken ) | Helical | NA | ||
| 19524300 | 2009 | RFGRFLRKIRRFRPK | C1-15 | Free | Free | Linear | L | None | 15 | Immunomodulatory and antimicrobial | 0% hemolysis at 40μM (non-hemolytic) | Chicken | Host defense peptide cathelicidin-2 (CATH-2) analog (Chicken ) | Helical | Non-hemolytic | ||
| 19524300 | 2009 | FRPKVTITIQGSARF{ct:Amid} | C12-26 | Amidation | Free | Linear | L | None | 15 | Immunomodulatory and antimicrobial | 0% hemolysis at 40μM | Chicken | Host defense peptide cathelicidin-2 (CATH-2) analog (Chicken ) | Helical | Non-hemolytic | ||
| 25941665 | 2015 | MKILCFFIVLLFVAVHGAVGFSRSPRYHM QCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL{nt:Acet} | AvBD-4 | Free | Acetylation | Linear | L | None | 64 | Antibacterial, Antifungal | 1 % Hemolysis at 12.5 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCFFIVLLFVAVHGAVGFSRSPRYHM QCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL{nt:Acet} | AvBD-4 | Free | Acetylation | Linear | L | None | 64 | Antibacterial, Antifungal | <3 % Hemolysis at 25 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCFFIVLLFVAVHGAVGFSRSPRYHM QCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL{nt:Acet} | AvBD-4 | Free | Acetylation | Linear | L | None | 64 | Antibacterial, Antifungal | <4 % Hemolysis at 50 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCFFIVLLFVAVHGAVGFSRSPRYHM QCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL{nt:Acet} | AvBD-4 | Free | Acetylation | Linear | L | None | 64 | Antibacterial, Antifungal | 6 % Hemolysis at 100 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCLLFAVLLFLFQAAPGSADPLFPDTVACRT QGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ{nt:Acet} | AvBD-10 | Free | Acetylation | Linear | L | None | 69 | Antibacterial, Antifungal | 1 % Hemolysis at 12.5 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCLLFAVLLFLFQAAPGSADPLFPDTVACRT QGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ{nt:Acet} | AvBD-10 | Free | Acetylation | Linear | L | None | 69 | Antibacterial, Antifungal | <3 % Hemolysis at 25 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCLLFAVLLFLFQAAPGSADPLFPDTVACRT QGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ{nt:Acet} | AvBD-10 | Free | Acetylation | Linear | L | None | 69 | Antibacterial, Antifungal | <3 % Hemolysis at 50 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 25941665 | 2015 | MKILCLLFAVLLFLFQAAPGSADPLFPDTVACRT QGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ{nt:Acet} | AvBD-10 | Free | Acetylation | Linear | L | None | 69 | Antibacterial, Antifungal | <6 % Hemolysis at 100 μg/mL | Chicken | Synthetic Chicken Β-Defensin | NA | Low hemolytic | ||
| 26914652 | 2016 | MRILFFLVAVLFFLFQAAPAYSQEDADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS | sAvBD-9 | Free | Free | Linear | L | None | 67 | Antimicrobial | 2 % Hemolysis at 12.5 μg/ml | Chicken | Chickens From Saudi Arabia | NA | NA | ||
| 26914652 | 2016 | MRILFFLVAVLFFLFQAAPAYSQEDADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS | sAvBD-9 | Free | Free | Linear | L | None | 67 | Antimicrobial | 3 % Hemolysis at 25 μg/ml | Chicken | Chickens From Saudi Arabia | NA | NA | ||
| 26914652 | 2016 | MRILFFLVAVLFFLFQAAPAYSQEDADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS | sAvBD-9 | Free | Free | Linear | L | None | 67 | Antimicrobial | 4 % Hemolysis at 50 μg/ml | Chicken | Chickens From Saudi Arabia | NA | NA | ||
| 26914652 | 2016 | MRILFFLVAVLFFLFQAAPAYSQEDADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS | sAvBD-9 | Free | Free | Linear | L | None | 67 | Antimicrobial | 5 % Hemolysis at 100 μg/ml | Chicken | Chickens From Saudi Arabia | NA | NA | ||
| 28630199 | 2017 | KRVKRFKKFFRKIKKGFRKIFKKTKIFIGGT | Pb-CATH1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 0 % Hemolysis at 4 μg/ml | Chicken | Python Bivittatus | α-Helix | Non-hemolytic | ||
| 28630199 | 2017 | KRVKRFKKFFRKIKKGFRKIFKKTKIFIGGT | Pb-CATH1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 1.4±0.4 % Hemolysis at 8 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | KRVKRFKKFFRKIKKGFRKIFKKTKIFIGGT | Pb-CATH1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 5.1±0.5 % Hemolysis at 16 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | KRVKRFKKFFRKIKKGFRKIFKKTKIFIGGT | Pb-CATH1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 7.3±0.6 % Hemolysis at 32 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | KRVKRFKKFFRKIKKGFRKIFKKTKIFIGGT | Pb-CATH1 | Free | Free | Linear | L | None | 31 | Antimicrobial | 12.2±0.7 % Hemolysis at 64 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | HRVKRNGFRKFMRRLKKFFAGG | Pb-CATH3 | Free | Free | Linear | L | None | 22 | Antimicrobial | 0 % Hemolysis at 4 μg/ml | Chicken | Python Bivittatus | α-Helix | Non-hemolytic | ||
| 28630199 | 2017 | HRVKRNGFRKFMRRLKKFFAGG | Pb-CATH3 | Free | Free | Linear | L | None | 22 | Antimicrobial | 0 % Hemolysis at 8 μg/ml | Chicken | Python Bivittatus | α-Helix | Non-hemolytic | ||
| 28630199 | 2017 | HRVKRNGFRKFMRRLKKFFAGG | Pb-CATH3 | Free | Free | Linear | L | None | 22 | Antimicrobial | 1.7±0.5 % Hemolysis at 16 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | HRVKRNGFRKFMRRLKKFFAGG | Pb-CATH3 | Free | Free | Linear | L | None | 22 | Antimicrobial | 3.1±0.5 % Hemolysis at 32 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | HRVKRNGFRKFMRRLKKFFAGG | Pb-CATH3 | Free | Free | Linear | L | None | 22 | Antimicrobial | 4.0±0.2 % Hemolysis at 64 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | TRSRWRRFIRGAGRFARRYGWRIAL | Pb-CATH4 | Free | Free | Linear | L | None | 25 | Antimicrobial | 0 % Hemolysis at 4 μg/ml | Chicken | Python Bivittatus | α-Helix | Non-hemolytic | ||
| 28630199 | 2017 | TRSRWRRFIRGAGRFARRYGWRIAL | Pb-CATH4 | Free | Free | Linear | L | None | 25 | Antimicrobial | 1.2±0.3 % Hemolysis at 8 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | TRSRWRRFIRGAGRFARRYGWRIAL | Pb-CATH4 | Free | Free | Linear | L | None | 25 | Antimicrobial | 3.2±0.4 % Hemolysis at 16 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | TRSRWRRFIRGAGRFARRYGWRIAL | Pb-CATH4 | Free | Free | Linear | L | None | 25 | Antimicrobial | 6.5±0.4 % Hemolysis at 32 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | TRSRWRRFIRGAGRFARRYGWRIAL | Pb-CATH4 | Free | Free | Linear | L | None | 25 | Antimicrobial | 10.7±0.2 % Hemolysis at 64 μg/ml | Chicken | Python Bivittatus | α-Helix | NA | ||
| 28630199 | 2017 | GIGAVLKVLTTGLPALISWIKRKRQQ | melittin | Free | Free | Linear | L | None | 26 | Antimicrobial | 13±1.1 % Hemolysis at 4 μg/ml | Chicken | Bee Venom | α-Helix | NA | ||
| 28630199 | 2017 | GIGAVLKVLTTGLPALISWIKRKRQQ | melittin | Free | Free | Linear | L | None | 26 | Antimicrobial | 71.3±5.2 % Hemolysis at 8 μg/ml | Chicken | Bee Venom | α-Helix | NA | ||
| 28630199 | 2017 | GIGAVLKVLTTGLPALISWIKRKRQQ | melittin | Free | Free | Linear | L | None | 26 | Antimicrobial | 110.3±1.5 % Hemolysis at 16 μg/ml | Chicken | Bee Venom | α-Helix | NA | ||
| 28630199 | 2017 | GIGAVLKVLTTGLPALISWIKRKRQQ | melittin | Free | Free | Linear | L | None | 26 | Antimicrobial | 114.7±1.7 % Hemolysis at 32 μg/ml | Chicken | Bee Venom | α-Helix | NA | ||
| 28630199 | 2017 | GIGAVLKVLTTGLPALISWIKRKRQQ | melittin | Free | Free | Linear | L | None | 26 | Antimicrobial | 113.4±0.2 % Hemolysis at 64 μg/ml | Chicken | Bee Venom | α-Helix | NA | ||
| 29890331 | 2018 | DLIWKLLVKAQEKFGRGKPSKRVKKMRRQWQACKSSHHHHHH | cLF36 | Free | Free | Linear | L | None | 42 | Antimicrobial | 4 % Hemolysis at 250 μg/ml | Chicken | Bacterial Escherichia Col | NA | Low hemolytic | ||
| 32738898 | 2020 | MNFSRVLVFVFACLVAMCA-VSAAPEPRWKVFKKIEKMGRNIRDGIIKAGPAVAVLGDAKALGK | Armyworm cecropin 1, AC-1 | Free | Free | Linear | L | None | 63 | Antibacterial | 14.47 ± 1.03 % Hemolysis at 500 µg/mL | Chicken | Armyworm Mythimna Separata | 20 mM PBS, pH 7.4 = anti-parallel (44.5%), β-Turn (22.6%), and Random coil (32.6%) | Low hemolytic | ||
| 34577539 | 2021 | CRRRGSPHC | mCA4-4 | Free | Free | Linear | L | None | 9 | Antibacterial | <6 % Hemolysis at 100 µM | Chicken | Chicken Angiogenin 4 (Chang4) | NA | Low hemolytic | ||
| 34577539 | 2021 | CRFKFRIVIC | mCA4-5 | Free | Free | Linear | L | None | 10 | Antibacterial | <6 % Hemolysis at 100 µM | Chicken | Chicken Angiogenin 4 (Chang4) | NA | Low hemolytic | ||
| 36760504 | 2023 | VNFKLLSHSLLVTLRSHL | HJH-3 | Free | Free | Linear | L | None | 18 | Antibacterial | 7.31 % Hemolysis at 100 μg/mL | Chicken | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 36760504 | 2023 | VNFKLLSHSLLVTLRSHL | HJH-3 | Free | Free | Linear | L | None | 18 | Antibacterial | 13.37 % Hemolysis at 400 μg/mL | Chicken | Synthetic Peptide | α-Helix | Low hemolytic | ||
| 36837754 | 2023 | INLKAIAALAKKLF{ct:Amid} | Mastoparan-AF | Amidation | Free | Linear | L | None | 14 | Antibacterial | >35 % Hemolysis at 256 μg/mL | Chicken | Hornet Venom Of Vespa Affinis | Water = Disordered, SDS = Helical | NA | ||
| 23409125 | 2013 | RLLFRKIRRLKR | EC5 | Free | Free | Linear | L | None | 12 | Antibacterial | 5 % Hemolysis at 500 μg/mL | Chicken | Peptide Synergists From Phage Display | NA | Low hemolytic | ||
| 27915018 | 2017 | WWWLKRIW{ct:Amid} | TetraF2W-KR | Amidation | Free | Linear | L | None | 8 | Antibacterial, Antifungal, candidacidal, Anti-MRSA, Hemolytic | 50 % Hemolytic at 35µM | Chicken | Synthetic Peptide | Rich | NA | ||
| 27915018 | 2017 | WWWLRKIW{ct:Amid} | TetraF2W-RK | Amidation | Free | Linear | L | None | 8 | Antibacterial, Antifungal, candidacidal, Anti-MRSA, Hemolytic | 50 % Hemolytic at 35µM | Chicken | Synthetic Peptide | Helix | NA | ||
| 27915018 | 2017 | WWWLKKIW{ct:Amid} | TetraF2W-KK | Amidation | Free | Linear | L | None | 8 | Antibacterial, Antifungal, candidacidal, Anti-MRSA, Hemolytic | 50 % Hemolytic at 50µM | Chicken | Synthetic Peptide | Rich | NA |