Browse result page of FermFooDB Database

This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.

The total number entries retrieved from this search are 7

FMDB_IDPubMed IDReferenceTitlePeptide_SequenceSequenceLength of peptideFood_Matrix Protein pHTemperatureIncubation TimeActivityExperimentModelAssay for Activity MeasurementCultureHydrolysisMethod of analysisM_Z ratioMassIC50
FMDB72322156436NANAYEWEPTVPNFDVAKDVTDMYEWEPTVPNFDVAKDVTDM19kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65proteinase and peptidasenano-LC-ESIMS/ MSNA 2255.0093NA
FMDB72422156436NANAGVSNAAVVAGGHGVSNAAVVAGGH12kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66proteinase and peptidasenano-LC-ESIMS/ MSNA 1037.5254NA
FMDB72522156436NANADAQEFKRDAQEFKR7kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67proteinase and peptidasenano-LC-ESIMS/ MSNA 892.4403NA
FMDB72622156436NANAPPGPGPGPPPPPGAAGRGGGGPPGPGPGPPPPPGAAGRGGGG21kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68proteinase and peptidasenano-LC-ESIMS/ MSNA 1704.8721NA
FMDB72722156436NANAHKEMQAIFDVYIMFINHKEMQAIFDVYIMFIN16kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69proteinase and peptidasenano-LC-ESIMS/ MSNA 2000.3734NA
FMDB72822156436NANATGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIRTGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR57kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70proteinase and peptidasenano-LC-ESIMS/ MSNA 5124.5196NA
FMDB72922156436NANADTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTRDTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR52kamutNA3.40 ± 0.03 to 3.88 ± 0.05.37C24hAntioxidantIn vitroNADPPH radical-scavenging activity & Inhibition of linoleic acid autoxidationLactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71proteinase and peptidasenano-LC-ESIMS/ MSNA 4921.2889NA