Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID159 | AAHLPAEFTPAVHASL | "Haemoglobin chain, alpha, chain A" | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID241 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin alpha | Serum | 3326.6863 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID243 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin alpha | Serum | 3473.7545 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID707 | AAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | 681.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID708 | WGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | "950.97, 634.31" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID709 | KVGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | 553.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID710 | VGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | 510.57 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID711 | AHAGEYGAEALERMFLSF | Hemoglobin subunit alpha | Plasma | 666.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID712 | GEYGAEALERMFLSFPTTK | Hemoglobin subunit alpha | Plasma | 716.5 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID713 | GEYGAEALERMFLSF | Hemoglobin subunit alpha | Plasma | 860.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID714 | GEYGAEALERMFL | Hemoglobin subunit alpha | Plasma | 743.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID715 | GEYGAEALERMF | Hemoglobin subunit alpha | Plasma | 686.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID716 | GEYGAEALERM | Hemoglobin subunit alpha | Plasma | 613.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID717 | TYFPHFDLSHGSAQVK | Hemoglobin subunit alpha | Plasma | 611.96 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID718 | TYFPHFDLSHGSAQV | Hemoglobin subunit alpha | Plasma | 853.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID719 | TYFPHFDLS | Hemoglobin subunit alpha | Plasma | 563.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID720 | SLDKFLASVST | Hemoglobin subunit alpha | Plasma | 584.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID721 | SLDKFLASV | Hemoglobin subunit alpha | Plasma | 490.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID722 | HLPAEFTPAVHA | Hemoglobin subunit alpha | Plasma | 645.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID723 | DALTNAVAHV | Hemoglobin subunit alpha | Plasma | 505.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID724 | ALTNAVAHVDDMPNALSALSD | Hemoglobin subunit alpha | Plasma | 1063.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID2223 | SLDKFLASVSTVLTSKYR | Hemoglobin subunit alpha | Serum | 2014.10989 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3421 | TPEEKSAVTAL | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3479 | AAHLPAEFTPAVHASLDKF | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3505 | SPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3510 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3512 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3635 | SDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3671 | HLPAEFTPAVHASLDKF | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3694 | AAHLPAEFTPAVHASLDKF | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3791 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3800 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3806 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4547 | DALTNAVAHVDDMPNALSAL | Hemoglobin subunit alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6964 | SLDKFLASVSTV | Hemoglobin subunit alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7453 | TLAAHLPAEFTPAVHA | Hemoglobin subunit alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7454 | TLAAHLPAEFTPAVHASLDKFLASV | Hemoglobin subunit alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7455 | TLAAHLPAEFTPAVHASLDKFLASVSTV | Hemoglobin subunit alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID10043 | PTTKTYFPHF | Hemoglobin subunit alpha | Urine | 1238.623 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10097 | AAHLPAEFTPAVH | Hemoglobin subunit alpha | Urine | 1360.7005 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10116 | LASVSTVLTSKYR | Hemoglobin subunit alpha | Urine | 1424.8133 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10121 | GKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 1429.7096 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10122 | HAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 1432.7829 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10197 | HAHKLRVDPVNFK | Hemoglobin subunit alpha | Urine | 1560.8761 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10215 | LSFPTTKTYFPHF | Hemoglobin subunit alpha | Urine | 1585.8043 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10234 | AAHLPAEFTPAVHASL | Hemoglobin subunit alpha | Urine | 1631.8469 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10260 | HAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 1673.9572 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10282 | FLSFPTTKTYFPHF | Hemoglobin subunit alpha | Urine | 1732.8911 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10291 | LAAHLPAEFTPAVHASL | Hemoglobin subunit alpha | Urine | 1744.9346 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10292 | SDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 1747.9214 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10362 | AAHLPAEFTPAVHASLDK | Hemoglobin subunit alpha | Urine | 1875.0317 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10391 | VTLAAHLPAEFTPAVHASL | Hemoglobin subunit alpha | Urine | 1945.0508 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10418 | SDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 1989.1011 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10426 | SALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 2019.0617 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10428 | AAHLPAEFTPAVHASLDKF | Hemoglobin subunit alpha | Urine | 2022.0399 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10441 | LVTLAAHLPAEFTPAVHASL | Hemoglobin subunit alpha | Urine | 2058.1277 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10461 | LSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 2102.1746 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10474 | AAHLPAEFTPAVHASLDKFL | Hemoglobin subunit alpha | Urine | 2135.1244 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10525 | SALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 2260.2508 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10534 | AAHLPAEFTPAVHASLDKFLAS | Hemoglobin subunit alpha | Urine | 2293.2203 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10547 | VTLAAHLPAEFTPAVHASLDKF | Hemoglobin subunit alpha | Urine | 2335.2281 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10553 | HAHKLRVDPVNFKLLSHCLL | Hemoglobin subunit alpha | Urine | 2340.3031 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10582 | VLSPADKTNVKAAWGKVGAHAGEY | Hemoglobin subunit alpha | Urine | 2469.2832 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10584 | AAHLPAEFTPAVHASLDKFLASVS | Hemoglobin subunit alpha | Urine | 2479.2756 | MALDI-TOF | Muscle-invasive bladder cancer | Upregulated in cancer vs normal | 21805675 |
| CancerPDF_ID10612 | VTLAAHLPAEFTPAVHASLDKFLAS | Hemoglobin subunit alpha | Urine | 2606.3727 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10620 | SDLHAHKLRVDPVNFKLLSHCLL | Hemoglobin subunit alpha | Urine | 2655.4468 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10627 | SPADKTNVKAAWGKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 2698.3394 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10631 | VLSPADKTNVKAAWGKVGAHAGEYGAE | Hemoglobin subunit alpha | Urine | 2726.3911 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10641 | LSDLHAHKLRVDPVNFKLLSHCLL | Hemoglobin subunit alpha | Urine | 2768.5407 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10646 | AAHLPAEFTPAVHASLDKFLASVSTVL | Hemoglobin subunit alpha | Urine | 2792.4821 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10647 | VLSPADKTNVKAAWGKVGAHAGEYGAEA | Hemoglobin subunit alpha | Urine | 2797.431 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10663 | LVTLAAHLPAEFTPAVHASLDKFLASVS | Hemoglobin subunit alpha | Urine | 2905.5638 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10664 | VLSPADKTNVKAAWGKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 2910.5136 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10668 | SALSDLHAHKLRVDPVNFKLLSHCLL | Hemoglobin subunit alpha | Urine | 2926.6099 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10682 | VTLAAHLPAEFTPAVHASLDKFLASVSTVL | Hemoglobin subunit alpha | Urine | 3105.6885 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10689 | VAHVDDMPNALSALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 3181.6283 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10690 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | 3195.6587 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10701 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin subunit alpha | Urine | 3326.7238 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10708 | VAHVDDMPNALSALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 3422.8282 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10710 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin subunit alpha | Urine | 3473.7931 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10714 | PTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 3523.8388 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10726 | LSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 3871.0499 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10729 | FLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 4018.1173 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10750 | ERMFLSF | Hemoglobin subunit alpha | Urine | 929.4521 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10762 | TVLTSKYR | Hemoglobin subunit alpha | Urine | 967.5594 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10992 | VLSPADKTNVKAAWGKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 2926.5099 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11003 | VAHVDDMPNALSALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 3197.6092 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11023 | VAHVDDMPNALSALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 3438.8067 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11087 | NA | HBA_HUMAN | Urine | 2790.7 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11100 | NA | HBA_HUMAN | Urine | 2790.7 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID12341 | SVSTVLTSK | Hemoglobin subunit alpha | Serum | NA | LC-MS | Melanoma | "Present in 4 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID13012 | SVSTVLTSK | Hemoglobin subunit alpha | Plasma | 921.526 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13213 | LSFPTTKTY | Hemoglobin subunit alpha | Plasma | 1057.557 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |