| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID3510 |
| PMID | 27026199 |
| Peptide Sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALER |
| Peptide Sequence in Publication | VLSPADKTNVKAAWGKVGAHAGEYGAEALER |
| Protein Name | Hemoglobin subunit alpha |
| UniprotKB Entry Name | HBA_HUMAN |
| Biofluid | Urine |
| M/Z | NA |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | 3194.65 |
| Profiling Technique | "CE-MS, Micro-TOF-MS" |
| Peptide Identification Technique | MS-MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | NA |
| p-Value | less than 0.05 |
| Software | Proteome Discoverer 1.2 |
| Length of Peptide | 31 |
| Cancer Type | Bladder cancer |
| Database for Peptide search | Uniprot Human non-redundant Database |
| Modification | NA |
| Number of Patients | 451 for training (341 patients and 110 normal) and 270 for testing(168 primary UBC patients and 102 normal controls); |
| Regulation/Differential Expression | Differentially expressed between primary UBC and normal individual |
| Validation | Independent Validation |
| Sensitivity | For testing dataset 91% |
| Specificity | For testing dataset 68% |
| Accuracy | For testing dataset 76% |
| Secondary information |
|---|
| Peptide Atlas | PeptideAtlas |
| IEDB | 120290
144530
144531
|