| Primary information |
|---|
| sequence ID | Seq_9169 |
| Peptide sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM |
| CancerPDF_ID | CancerPDF_ID241, CancerPDF_ID10701, |
| PMID | 19728888,21805675 |
| Protein Name | Hemoglobin alpha,Hemoglobin subunit alpha |
| UniprotKB Entry Name | HBA_HUMAN,HBA_HUMAN |
| Fluid | Serum,Urine |
| M/Z | 3326.6863,3326.7238 |
| Charge | NA,NA |
| Mass (in Da) | NA,NA |
| fdr | NA,NA |
| Profiling Technique | MALDI-TOF,MALDI-TOF |
| Peptide Identification technique | LC-MS/MS,MALDI-TOF-MS |
| Quantification Technique | NA,NA |
| Labelled/Label Free | Label Free,Label Free |
| FDR | NA,1 |
| CancerPDF_ID | CancerPDF_ID241, CancerPDF_ID10701, |
| p-Value | less than 0.01,NA |
| Software | MASCOT(v 2.0.04 for Windows),NA |
| Length | 32,32 |
| Cancer Type | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy",Muscle-invasive bladder cancer |
| Database | SwissProt Database (release 54.7),SwissProt Database |
| Modification | NA,NA |
| Number of Patients | "27 patients, 13 normal individuals",751 bladder cancer and 127 control |
| Regulation | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers,Differentially expressed between cancer vs normal samples |
| Validation | Independent validation,Mann-Whitney tests and areas under receiver-operator characteristic |
| Sensitivity | 1,NA |
| Specificity | 0.96,NA |
| Accuracy | 0.98,NA |
| Peptide Atlas | NA |
| IEDB | |
| Primary information |
|---|
| sequence ID | Seq_9171 |
| Peptide sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm |
| CancerPDF_ID | CancerPDF_ID3512, CancerPDF_ID3800, CancerPDF_ID3806, |
| PMID | 27026199,27026199,27026199 |
| Protein Name | Hemoglobin subunit alpha,Hemoglobin subunit alpha,Hemoglobin subunit alpha |
| UniprotKB Entry Name | HBA_HUMAN,HBA_HUMAN,HBA_HUMAN |
| Fluid | Urine,Urine,Urine |
| M/Z | NA,NA,NA |
| Charge | NA,NA,NA |
| Mass (in Da) | NA,NA,NA |
| fdr | 3341.69,3341.68,3341.7 |
| Profiling Technique | "CE-MS, Micro-TOF-MS","CE-MS, Micro-TOF-MS","CE-MS, Micro-TOF-MS" |
| Peptide Identification technique | MS-MS,MS-MS,MS-MS |
| Quantification Technique | NA,NA,NA |
| Labelled/Label Free | Label Free,Label Free,Label Free |
| FDR | NA,NA,NA |
| CancerPDF_ID | CancerPDF_ID3512, CancerPDF_ID3800, CancerPDF_ID3806, |
| p-Value | less than 0.05,less than 0.01,less than 0.01 |
| Software | Proteome Discoverer 1.2,Proteome Discoverer 1.2,Proteome Discoverer 1.2 |
| Length | 32,32,32 |
| Cancer Type | Bladder cancer,Bladder cancer,Bladder cancer |
| Database | Uniprot Human non-redundant Database,Uniprot Human non-redundant Database,Uniprot Human non-redundant Database |
| Modification | m: Oxidized-Methionine,m:Oxidized Methionine,m:Oxidized-Methionine |
| Number of Patients | 451 for training (341 patients and 110 normal) and 270 for testing(168 primary UBC patients and 102 normal controls);, 425 for training(109 patients with Recurrent UBC cases and 316 negative for recurrence controls) and 211 for validation (55 UBC recurrent cases and 156 recurrent controls), 425 for training(109 patients with Recurrent UBC cases and 316 negative for recurrence controls) and 211 for validation (55 UBC recurrent cases and 156 recurrent controls) |
| Regulation | Differentially expressed between primary UBC and normal individual,Differentially expressed between recurrence of UBC vs recurrence control,Differentially expressed between recurrence of UBC vs recurrence control |
| Validation | Independent Validation,Independent Validation,Independent Validation |
| Sensitivity | For testing dataset 91%,For testing dataset 88%,For testing dataset 88% |
| Specificity | For testing dataset 68%,For testing dataset 51%,For testing dataset 51% |
| Accuracy | For testing dataset 76%,NA,NA |
| Peptide Atlas | NA |
| IEDB | |