| Primary information |
|---|
| sequence ID | Seq_9168 |
| Peptide sequence | VLSPADKTNVKAAWGKVGAHAGEYGAEALER |
| CancerPDF_ID | CancerPDF_ID3510, CancerPDF_ID3791, CancerPDF_ID10690, |
| PMID | 27026199,27026199,21805675 |
| Protein Name | Hemoglobin subunit alpha,Hemoglobin subunit alpha,Hemoglobin subunit alpha |
| UniprotKB Entry Name | HBA_HUMAN,HBA_HUMAN,HBA_HUMAN |
| Fluid | Urine,Urine,Urine |
| M/Z | NA,NA,3195.6587 |
| Charge | NA,NA,NA |
| Mass (in Da) | NA,NA,NA |
| fdr | 3194.65,3194.65,NA |
| Profiling Technique | "CE-MS, Micro-TOF-MS","CE-MS, Micro-TOF-MS",MALDI-TOF |
| Peptide Identification technique | MS-MS,MS-MS,MALDI-TOF-MS |
| Quantification Technique | NA,NA,NA |
| Labelled/Label Free | Label Free,Label Free,Label Free |
| FDR | NA,NA,1 |
| CancerPDF_ID | CancerPDF_ID3510, CancerPDF_ID3791, CancerPDF_ID10690, |
| p-Value | less than 0.05,less than 0.001,NA |
| Software | Proteome Discoverer 1.2,Proteome Discoverer 1.2,NA |
| Length | 31,31,31 |
| Cancer Type | Bladder cancer,Bladder cancer,Muscle-invasive bladder cancer |
| Database | Uniprot Human non-redundant Database,Uniprot Human non-redundant Database,SwissProt Database |
| Modification | NA,NA,NA |
| Number of Patients | 451 for training (341 patients and 110 normal) and 270 for testing(168 primary UBC patients and 102 normal controls);, 425 for training(109 patients with Recurrent UBC cases and 316 negative for recurrence controls) and 211 for validation (55 UBC recurrent cases and 156 recurrent controls),751 bladder cancer and 127 control |
| Regulation | Differentially expressed between primary UBC and normal individual,Differentially expressed between recurrence of UBC vs recurrence control,Differentially expressed between cancer vs normal samples |
| Validation | Independent Validation,Independent Validation,Mann-Whitney tests and areas under receiver-operator characteristic |
| Sensitivity | For testing dataset 91%,For testing dataset 88%,NA |
| Specificity | For testing dataset 68%,For testing dataset 51%,NA |
| Accuracy | For testing dataset 76%,NA,NA |
| Peptide Atlas | PeptideAtlas |
| IEDB | 120290
144530
144531
|