Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID3412 | DGESGRpGRpGERGLpGPpG | Collagen alpha-1(III) chain | Urine | NA | CE-MS-TOF | Bladder cancer | Upregulated in cancer vs normal | 21591268 |
| CancerPDF_ID3420 | GGpGSDGKpGPpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3456 | GPpGPpGTSGHPGSpGSpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3475 | GApGApGGKGDAGAPGERGppG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3483 | GpTGpIGPpGpAGQPGDKGEGGAP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3497 | NRGERGSEGSPGHpGQPGPpGPPGApGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3499 | ERGEAGIpGVpGAKGEDGKDGSpGEpGA | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3540 | DGESGRpGRpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3546 | GHPGQPGpPGPpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3579 | GLpGTGGPpGENGKpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3593 | GLpGpPGSNGNPGPpGp | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3600 | EGSPGHPGQpGPpGPpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3608 | GInGSPGGKGEMGpAGIP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3619 | GPpGPpGTSGHPGSpGSpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3633 | GPpGPTGPGGDKGDTGPpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3641 | NDGARGSDGQPGPPGppGT | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3647 | NDGARGSDGQPGPPGppGT | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3654 | GLpGTGGPpGENGKPGEPGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3655 | GpAGSpGSNGApGQRGEpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3657 | GLpGTGGPpGENGKPGEPGp | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3659 | pGPpGTSGHpGSPGSPGYQG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3663 | GpEGAQGPRGEpGTPGSpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3665 | NpGPPGpSGSpGKDGPpGPAG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3669 | pPGPTGPGGDKGDTGPpGPQG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3675 | GApGApGGKGDAGAPGERGppG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3701 | GSNGNpGpPGPSGSpGKDGPpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3706 | GPGMRGMPGSPGGpGSDGKpGpP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3712 | GDAGApGAPGGKGDAGApGERGpPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3713 | GpTGpIGPpGpAGQPGDKGEGGAP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3724 | KGDAGApGApGGKGDAGApGERGpPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3729 | QNGEpGGKGERGApGEKGEGGppG | "Collagen alpha-1(III) chain, COL3A1" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3756 | ApGPAGSRGApGPQGpRGDKGETGERG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3757 | GApGQNGEPGGKGERGApGEKGEGGppG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3767 | SGHPGSPGSPGYQGPpGEPGQAGPSGPpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3789 | QGpPGKNGETGPQGPPGPTGPGGDKGDTGPpGPQG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3803 | pGAKGEVGpAGSpGSNGAPGQRGEPGPQGHAGAQGpPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3820 | SNGNpGPPGPSGSPGKDGPPGpAGNTGApGSpGVSGPKGDAGQPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4047 | AAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4168 | AGAPGAPGGKGDAGAPGERGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4170 | AGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4175 | AGITGARGLAGPPGMPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4185 | AGQPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4186 | AGQPGEKGSPGAQGPPGAPGPLG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4192 | AGTAGEPGRDGNPGSD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4193 | AGTAGEPGRDGNPGSDGLPGRD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4308 | APGAPGGKGDAGAPGERGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4356 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGA | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4584 | DGQPGPPGPPGTAGFPGSPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4731 | EGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5087 | GADGVPGKD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5091 | GAPGAPGGKGDAGAPGERGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5093 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5193 | GLAGTAGEPGRDGNPGSD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5194 | GLAGTAGEPGRDGNPGSDGLPGRD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5229 | GMPGSPGGPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5231 | GNDGARGSD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5237 | GPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5256 | GPPGSNGNPGPPGPSGSPGKD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5310 | GTAGEPGRDGNPGSD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5311 | GTAGEPGRDGNPGSDGLPGRD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5413 | IAGITGARGLAGPPGMPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5984 | LPGLAGTAGEPGRD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6223 | MPGSPGGPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6257 | NDGAPGKNGERGGPGGPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6404 | PGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6429 | PPGPTGPGGDKGDTGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6527 | QGLPGLAGTAGEPGRD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6528 | QGLPGLAGTAGEPGRDGNPGSD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6529 | QGLPGTGGPPGENGKPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6531 | QGPPGPTGPGGDKGD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6564 | QPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6668 | RGENGSPGAPGAPGHPGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6671 | RGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6779 | SDGQPGPPGPPGTAGFPGSPGAKGEVGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7037 | SPGGPGSDGKPGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7344 | TAGEPGRDGNPGSDGLPGRD | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7570 | TSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID10107 | DGVPGKDGPRGPTGP | Collagen alpha-1(III) chain | Urine | 1406.6719 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10473 | PGAKGEDGKDGSPGEPGANGLPGA | Collagen alpha-1(III) chain | Urine | 2134.9569 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10781 | SPGERGETGPPGP | Collagen alpha-1(III) chain | Urine | 1269.5617 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10795 | GLPGTGGPPGENGKPG | Collagen alpha-1(III) chain | Urine | 1439.6662 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10808 | APGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 1595.7246 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10809 | DGAPGKNGERGGPGGPGP | Collagen alpha-1(III) chain | Urine | 1624.724 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10813 | GLPGTGGPPGENGKPGEP | Collagen alpha-1(III) chain | Urine | 1681.7451 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10816 | ESGRPGPPGPSGPRGQPG | Collagen alpha-1(III) chain | Urine | 1734.8147 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10818 | NDGAPGKNGERGGPGGPGP | Collagen alpha-1(III) chain | Urine | 1738.7711 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10825 | GESGRPGPPGPSGPRGQPG | Collagen alpha-1(III) chain | Urine | 1791.8324 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10826 | GNDGAPGKNGERGGPGGPGP | Collagen alpha-1(III) chain | Urine | 1795.7895 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10831 | GLPGTGGPPGENGKPGEPGP | Collagen alpha-1(III) chain | Urine | 1835.8664 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10832 | GLPGTGGPPGENGKPGEPGP | Collagen alpha-1(III) chain | Urine | 1835.8387 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10833 | APGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 1836.85 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10834 | APGGKGDAGAPGERGPPGLAG | Collagen alpha-1(III) chain | Urine | 1836.8793 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10839 | GAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 1893.8628 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10843 | KDGESGRPGRPGERGLPGP | Collagen alpha-1(III) chain | Urine | 1934.9728 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10846 | KDGESGRPGRPGERGLPGP | Collagen alpha-1(III) chain | Urine | 1950.9633 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10848 | EPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 1967.9029 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10850 | DGESGRPGRPGERGLPGPPG | Collagen alpha-1(III) chain | Urine | 1992.9404 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10851 | DGESGRPGRPGERGLPGPPG | Collagen alpha-1(III) chain | Urine | 2008.9332 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10853 | GIPGEKGPAGERGAPGPAGPRG | Collagen alpha-1(III) chain | Urine | 2017.0132 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10854 | GEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2024.9347 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10855 | SEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2026.856 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10858 | DAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 2063.9189 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10860 | DAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 2079.9266 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10869 | NGIPGEKGPAGERGAPGPAGPRG | Collagen alpha-1(III) chain | Urine | 2131.0582 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10872 | GDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 2136.9478 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10873 | NGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2138.9753 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10874 | NGIPGEKGPAGERGAPGPAGPRG | Collagen alpha-1(III) chain | Urine | 2147.0405 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10877 | NGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2154.9697 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10882 | SDGQPGPPGPPGTAGFPGSPGAKG | Collagen alpha-1(III) chain | Urine | 2169.9663 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10888 | NDGAPGKNGERGGPGGPGPQGPPG | Collagen alpha-1(III) chain | Urine | 2190.9709 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10903 | KGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 2265.0274 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10904 | QNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2267.0218 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10908 | QNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2283.0055 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10914 | GQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2324.0398 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10921 | ERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2369.0258 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10925 | RGGAGPPGPEGGKGAAGPPGPPGAAGTPG | Collagen alpha-1(III) chain | Urine | 2413.113 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10939 | APGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2508.1252 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10942 | APGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2524.1102 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10943 | LRGGAGPPGPEGGKGAAGPPGPPGAAGTPG | Collagen alpha-1(III) chain | Urine | 2526.2258 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10945 | LRGGAGPPGPEGGKGAAGPPGPPGAAGTPG | Collagen alpha-1(III) chain | Urine | 2542.2087 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10947 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2549.1613 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10948 | KNGETGPQGPPGPTGPGGDKGDTGPPGP | Collagen alpha-1(III) chain | Urine | 2558.1569 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10950 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2565.1498 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10952 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2581.145 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10965 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2648.1994 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10967 | ERGEAGIPGVPGAKGEDGKDGSPGEPGA | Collagen alpha-1(III) chain | Urine | 2655.2113 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10968 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2664.2119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10970 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2680.1757 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10972 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2696.2304 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10974 | KNGETGPQGPPGPTGPGGDKGDTGPPGPQG | Collagen alpha-1(III) chain | Urine | 2727.2526 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10976 | NDGARGSDGQPGPPGPPGTAGFPGSPGAKG | Collagen alpha-1(III) chain | Urine | 2740.2117 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10977 | KNGETGPQGPPGPTGPGGDKGDTGPPGPQG | Collagen alpha-1(III) chain | Urine | 2743.2447 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10982 | ERGEAGIPGVPGAKGEDGKDGSPGEPGANG | Collagen alpha-1(III) chain | Urine | 2810.2794 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10983 | LRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQG | Collagen alpha-1(III) chain | Urine | 2824.4013 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10984 | ERGEAGIPGVPGAKGEDGKDGSPGEPGANG | Collagen alpha-1(III) chain | Urine | 2826.275 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10990 | GMPGSPGGPGSDGKPGPPGSQGESGRPGPPGP | Collagen alpha-1(III) chain | Urine | 2921.2391 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10999 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKG | Collagen alpha-1(III) chain | Urine | 3024.3801 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11000 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3059.3961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11002 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3075.3859 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11006 | ENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 3243.4948 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11008 | ENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 3259.5101 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11012 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGP | Collagen alpha-1(III) chain | Urine | 3272.4927 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11013 | ENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 3275.4979 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11015 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGP | Collagen alpha-1(III) chain | Urine | 3288.4952 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11016 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGP | Collagen alpha-1(III) chain | Urine | 3304.4968 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11017 | ERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAG | Collagen alpha-1(III) chain | Urine | 3308.504 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11019 | GAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3373.5214 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11021 | VKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGP | Collagen alpha-1(III) chain | Urine | 3386.609 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11022 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGP | Collagen alpha-1(III) chain | Urine | 3406.5192 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11024 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLG | Collagen alpha-1(III) chain | Urine | 3458.629 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11025 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLG | Collagen alpha-1(III) chain | Urine | 3474.6119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11026 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQG | Collagen alpha-1(III) chain | Urine | 3736.6961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11027 | NDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG | Collagen alpha-1(III) chain | Urine | 4022.7806 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11031 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG | Collagen alpha-1(III) chain | Urine | 4306.9377 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11032 | LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 4323.0038 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |