Browse result page of AntiTbPdb
The total number entries retrieved from this search are 547
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1443 | A2-Ag85B | KLVANNTRL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1444 | A2-Ag85B | FIYAGSLSA | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1445 | A2-ESAT6 | AMASTEGNV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1446 | A2-ESAT | LLDEGKQSL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1447 | A2-Rv2958 | ALADLPVTV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1448 | A2-Rv2957 | SIIIPTLNV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1449 | A2-Rv0447 | VLAGSVDEL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1450 | A24-TB10.4 | IMYNYPAML | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1451 | A24-Ag85B | WYYQSGLSI | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1452 | A24-Ag85B | FLTSELPQW | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1453 | A24-Ag85B | IYAGSLSAL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1454 | A24-ESAT6 | AYQGVQQKW | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1455 | A24-ESAT6 | ELNNALQNL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1456 | A24-Rv2958 | KYIAADRKI | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1457 | A24-Rv2957 | PYNLRYRVL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1458 | A24-Rv0447 | KYIFPGGLL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1459 | A3001-TB10.4 | QIMYNYPAM | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1460 | A3001-TB10.4 | LVRAYHAMS | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1461 | A3001-Rv2957 | IVLVRRWPK | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2957 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2957 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1462 | A3002-TB10.4 | QIMYNYPAM | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1463 | A3002-TB10.4 | IMYNYPAML | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1464 | A3002-TB10.4 | AMEDLVRAY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1465 | A3002-ESAT6 | AMASTEGNV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1466 | A3002-Rv2958 | SARLAGIPY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1467 | A3002-Rv0447 | RMWELYLAY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1468 | A68-TB10.4 | HAMSSTHEA | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1469 | A68-TB10.4 | ANTMAMMAR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1470 | A68-Ag85B | LPQWLSANR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1471 | A68-Ag85B | WGAQLNAMK | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1472 | A68-Rv2958 | AAPEPVARR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1473 | A68-Rv2957 | LVYGDVIMR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2957 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2957 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1474 | A68-Rv0447 | AASAAIANR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1475 | B58-Ag85B | QTYKWETFL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1476 | Cw07-Ag85B | ANNTRLWVY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1514 | Hirsutatins A | not available | Free | Free | None | Branched cyclic | 0 | D | Cationic | Natural | Derived from Hirsutellanivea | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =50 mg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25681127 |
| antitb_1515 | Hirsutatins B | not available | Free | Free | None | Branched cyclic | 0 | D | Cationic | Natural | Derived from Hirsutellanivea | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 50 mg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25681127 |
| antitb_1516 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in growth is inhibited to to 30 % at conc. 6.25 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1517 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in growth is inhibited to to80% at conc. 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1518 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = 17± 9 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1519 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 (MDR resistant stain) | IC50= 93± 12 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1520 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium smegmatis | Mycobacterium smegmatis susceptible strain | 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1521 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1522 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 (MDR resistant stain) | IC50= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1523 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium avium | Mycobacterium avium susceptible strain | MIC= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1524 | NK-Lysin | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD | Free | Free | None | Linear | 36 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 60% at conc. Of 9.37 mg/L | in vitro | NA | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1525 | N22 | VCEHIHLIRGLCHHLMHSYIKR | Free | Free | None | Linear | 21 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 59% at conc. Of 50 mg/L | in vitro | NA | NA | Low toxicity to erythrocyte | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1526 | NKLF2 | VCDKMKILRGVCKKIMRSFLRR | Free | Free | None | Linear | 21 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1528 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 2.1 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | C57BL/6 Mice | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1529 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 18 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 25 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1530 | D5 | KWKSFLKTFKSLKKTKLHTLLKLISS | Acetylation | Amidation | None | Linear | 27 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 35.2 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |