Browse result page of AntiTbPdb
The total number entries retrieved from this search are 547
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1907 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1908 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1909 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1910 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1911 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1912 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 8 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1913 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis mc2 6020 | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1914 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG pasteur strain | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1949 | YD-1 | APKGVQGPNG | Free | Amidation | None | Linear | 10 | L | NA | Natural | Derived from Bacillus amyloliquefaciens CBSYD1 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 9341 | MIC = 8 μg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against gram negative such as Alcaligenes faecalis ATCC 1004, Salmonella Typhimurium KCTC 1925 etc and gram positive bacteria such as Enterococcus faecalis ATCC 29212, Micrococcus luteus ATCC 9341, Staphylococcus aureus KCTC 1928 | 2017 | 28050849 |
| antitb_1950 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO01 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1951 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO06 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1952 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO08 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1966 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.2 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1967 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1968 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1969 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1970 | CM-II protein, Sarcotoxin IA | GWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG | Free | Amidation | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | >100 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1971 | Sapecin | ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN | Free | Free | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | 78 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1972 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 90% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | Perforin (2000 U/ml)+granulysin (25 µM) | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
| antitb_1973 | Granulysin | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL | Free | Free | None | Linear | 123 | Mix | Cationic | Natural | Homo sapiens | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 10-15% Killing | In vivo | CD8+ T | NA | NA | NA | NA | NA | Altering Membrane Permeability | cell wall (lipid bilayer) | NA | Cryptococcus neoformans, Candida albicans, Leishmania major, S. typhimurium, L. monocytogenes, E. coli, and Staphylococcus aureus | 1988 | 9756476 |
| antitb_1974 | KSL | KKVVFKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC=6.25µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1975 | KSL1 | KKVVVKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 608 | MIC=3.12µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1976 | KSL2 | KKVVFKFKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 609 | MIC=3.12µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1977 | KSL3 | KKLLFKLKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 610 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1978 | KSL4 | KKLLFKLKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 611 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1979 | KSL5 | KKVVPKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 612 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1986 | pVEC | LLIILRRRIRKQAHAHSK | Free | Amidation | None | Linear | 18 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC=10µM | In vitro | HeLa cells | NA | NA | NA | NA | NA | NA | cell wall | NA | Bacillus subtilis, Staphylococcus epidermidis, Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella typhimurium, Bacillus subtilis, Candida albicans etc. | 2003 | 14656995 |
| antitb_1987 | TP10 | AGYLLGKINLKALAALAKKIL | Free | Amidation | None | Linear | 21 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC=6µM | In vitro | HeLa cells | NA | NA | NA | NA | NA | NA | cell wall | NA | Bacillus subtilis, Staphylococcus epidermidis, Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella typhimurium, Bacillus subtilis, Candida albicans etc. | 2003 | 14656995 |
| antitb_1989 | Ds-defensin | VPAESEAAHLRVRRGFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYRN | Free | Free | None | Linear | 52 | L | NA | Natural | Dermacentor silvarum | Mycobacterium bovis | Mycobacterium bovis (carbenicillin-resistant strain) | MIC= 20 µM | In vitro | NA | NA | NA | NA | NA | NA | Bacterial lycis | Cell wall | NA | Four Gram-positive bacteria, namely, Staphylococcus aureus (CMCC26003), Bacillus pumilus (CMCC63202), Micrococcus luteus (CMCC63202), and Mycobacterium bovis (carbenicillin-resistant strain); and three Gram-negative bacteria, namely, Salmonella typhimurium (CVCC542), Pseudomonas aeruginosa (CVCC2000), and Escherichia coli (CMCC44103), | 2015 | 25588982 |
| antitb_1990 | VpAmp1.0 | LPFFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 19 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 17.4 ± 6.4 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1991 | VpAmp1.0 | LPFFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 19 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 4.8 ± 1.5µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1992 | VpAmp1.1 | FFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 17 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 5.4 ± 1.7 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1993 | VpAmp1.1 | FFLLSLIPSAISAIKKI | Free | Amidation | None | Linear | 17 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.6 ± 3.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1994 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 21.4 ± 7.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1995 | VpAmp2.0 | FWGFLGKLAMKAVPSLIGGNKSSSK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 30.5 ± 9.5 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1996 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 13.6 ± 5.3 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1997 | VpAmp2.1 | FWGFLGKLAMKAVPSLIGGNKK | Free | Free | None | Linear | 22 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC= 8.5 ± 2.6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall | NA | Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus agalactiae | 2015 | 26352292 |
| antitb_1998 | Apidaecin Ia acid( A24 C3) | GNNRPVYIPQPRPPHPRI | Free | Free | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = >125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_1999 | Api Ib 01 ac.(A18 G5 ac) | ONNRPVYIPQPRPPHPRL | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2000 | Â Api Ib 01 (A18 G5) | ONNRPVYIPQPRPPHPRL | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2001 | Api Ib Ol RlO (Al 8 G6) | ONNRPVYIPRPRPPHPRL | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2002 | Api Ib Ol RlO ac. | ONNRPVYIPRPRPPHPRL | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2003 | Api Ia Ol RlO ac (A18 A2 ac) | ONNRPVYIPRPRPPHPRI | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 62.5 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2004 | Api . Ib RlO (Al 8 A5) | GNNRPVYIPRPRPPHPRL | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2005 | Api Ib RlO acety. (A18 A5 ac ) | GNNRPVYIPRPRPPHPRL | Acetylation | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2007 | Â Api Ia, OIO ( Al 7 A4 ) | GNNRPVYIPOPRPPHPRI | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |
| antitb_2010 | Api Ib K4 RlO Vl 9 (Al 8 Bl) | GNNKPVYIPRPRPPHPRLV | Free | Amidation | None | Linear | 18 | L | Cationic | Synthetic | Mycobaclerium vaccae | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 125 | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Anti bacterial against - Eschericha coli 45849 and D31, - Klebsiella pneumoniae 123132 and K6,Salmonella typhi S5 and Salmonella enterica subsp. enterica serovar Typhimurium, Rhizobium radiobacter, Klebsiella pneumoniae, Bactillus subtillis | 2010 | US 0222268 A1/E |