A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
Th1215 details |
| Primary information | |
|---|---|
| ID | 1824 |
| ThPP ID | Th1215 |
| Therapeutic Peptide/Protein Name | Thyroglobulin |
| Sequence | MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVP view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 660 |
| Chemical Formula | NA |
| Isoelectric Point | |
| Hydrophobicity | |
| Melting Point (℃) | |
| Half Life | 65 hours |
| Description | Thyroglobulin (also known as Tg) is an enzyme thyroid hormone used by the thyroid gland to produce the thyroid hormones thyroxine (T4) and triiodothyronine (T3). The active form of thyroxine, triiodothyronine, is produced both within the thyroid gland and periphery by 5’-deiodinase. Patients with Hashimoto’s thyroiditis or Graves’ disease, frequently develop antibodies against thyroglobulin. Thyroglobulin is used to treat hypothyroidism. |
| Indication/Disease | For the treatment of hypothyroidism (deficiency in the production of thyroid hormone). |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| Volume of Distribution | NA |
| Clearance | NA |
| Categories | Hormone therapy |
| Patents Number | US5099001 |
| Date of Issue | 28/12/89 |
| Date of Expiry | 28/12/09 |
| Drug Interaction | NA |
| Target | NA |
| Information of corresponding available drug in the market | |
| Brand Name | NA |
| Company | NA |
| Brand Discription | NA |
| Prescribed for | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physcial Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | Thyroglobulin has been shown to interact with Binding immunoglobulin protein. |
| Side Effects | NA |
| Useful Link | http://www.mythyroid.com/thyroglobulin.html |
| PubMed ID | 27912770, 25702290, 24930451, 24021785, 23469650, 23439301, 23389953, 22148004, 20456713 |
| 3-D Structure | Th1215 (View) or (Download) |
| Primary information | |
|---|---|
| ID | 1825 |
| ThPP ID | Th1215 |
| Therapeutic Peptide/Protein Name | Thyroglobulin |
| Sequence | MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVP view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 660 |
| Chemical Formula | NA |
| Isoelectric Point | |
| Hydrophobicity | |
| Melting Point (℃) | |
| Half Life | 65 hours |
| Description | Thyroglobulin (also known as Tg) is an enzyme thyroid hormone used by the thyroid gland to produce the thyroid hormones thyroxine (T4) and triiodothyronine (T3). The active form of thyroxine, triiodothyronine, is produced both within the thyroid gland and periphery by 5’-deiodinase. Patients with Hashimoto’s thyroiditis or Graves’ disease, frequently develop antibodies against thyroglobulin. Thyroglobulin is used to treat hypothyroidism. |
| Indication/Disease | For the treatment of hypothyroidism (deficiency in the production of thyroid hormone). |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| Volume of Distribution | NA |
| Clearance | NA |
| Categories | Hormone therapy |
| Patents Number | US3368940 |
| Date of Issue | 20/04/64 |
| Date of Expiry | 20/04/84 |
| Drug Interaction | NA |
| Target | NA |
| Information of corresponding available drug in the market | |
| Brand Name | NA |
| Company | NA |
| Brand Discription | NA |
| Prescribed for | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physcial Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | Thyroglobulin has been shown to interact with Binding immunoglobulin protein. |
| Side Effects | NA |
| Useful Link | http://www.mythyroid.com/thyroglobulin.html |
| PubMed ID | 27912770, 25702290, 24930451, 24021785, 23469650, 23439301, 23389953, 22148004, 20456713 |
| 3-D Structure | Th1215 (View) or (Download) |