Primary information |
---|
ID | 1803 |
ThPP ID | Th1197 |
Therapeutic Peptide/Protein Name | Sebelipase alfa |
Sequence | SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRK view full sequnce in fasta |
Functional Classification | Ia |
Molecular Weight | 55000 |
Chemical Formula | C1968H2945N507O551S15 |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting Point (℃) | NA |
Half Life | 5.4-6.6 mins |
Description | Sebelipase alfa is a recombinant form of the enzyme lysosomal acid lipase (LAL) approved for the treatment of lysosomal acid lipase deficiency (LAL-D). The amino acid sequence for sebelipase alfa is the same as the amino acid sequence for human LAL. Sebelipase alfa is an orphan drug which is expected to cost about $310,000 for annual treatment in the United States. Sebelipase alfa is marketed under the brand name Kanumaâ„¢ by Alexion Pharmaceuticals, Inc. |
Indication/Disease | Sebelipase alfa is a hydrolytic lysosomal cholesteryl ester and triacylglycerol-specific enzyme indicated for the treatment of patients with a diagnosis of Lysosomal Acid Lipase (LAL) deficiency. |
Pharmacodynamics | In clinical trials, after initiation of dosing with KANUMA, breakdown of accumulated lysosomal lipid led to initial increases in LDL-c and triglycerides within the first 2 to 4 weeks of treatment. In general, following increases in LDL-c and triglycerides, these parameters decreased to below pre-treatment values within 8 weeks of treatment with KANUMA. |
Mechanism of Action | LAL deficiency is an autosomal recessive lysosomal storage disorder characterized by a genetic defect resulting in a marked decrease or loss in activity of the lysosomal acid lipase (LAL) enzyme. The primary site of action of the LAL enzyme is the lysosome, where the enzyme normally causes the breakdown of lipid particles including LDL-c. Deficient LAL enzyme activity results in progressive complications due to the lysosomal accumulation of cholesteryl esters and triglycerides in multiple organs, including the liver, spleen, intestine, and the walls of blood vessels. The resulting lipid accumulation in the liver may lead to increased liver fat content and progression of liver disease, including fibrosis and cirrhosis. Lipid accumulation in the intestinal wall leads to malabsorption and growth failure. In parallel, dyslipidemia due to impaired degradation of lysosomal lipid is common with elevated LDL-c and triglycerides and low HDL-cholesterol (HDL-c). Sebelipase alfa binds to cell surface receptors via glycans expressed on the protein and is subsequently internalized into lysosomes. Sebelipase alfa catalyzes the lysosomal hydrolysis of cholesteryl esters and triglycerides to free cholesterol, glycerol and free fatty acids. |
Toxicity | NA |
Metabolism | NA |
Absorption | 942-1861 ng•hr/mL |
Volume of Distribution | 3.6-5.3 L |
Clearance | 31.1-38.2 L/hr |
Categories | Enzymes |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | NA |
Information of corresponding available drug in the market |
---|
Brand Name | Kanuma |
Company | Alexion Pharmaceuticals, Inc. |
Brand Discription | KANUMA (sebelipase alfa) is a recombinant human lysosomal acid lipase (rhLAL). Lysosomal acid lipase (EC 3.1.1.13) is a lysosomal glycoprotein enzyme that catalyzes the hydrolysis of cholesteryl esters to free cholesterol and fatty acids and the hydrolysis of triglycerides to glycerol and free fatty acids. |
Prescribed for | KANUMAâ„¢ is indicated for the treatment of patients with a diagnosis of Lysosomal Acid Lipase (LAL) deficiency. |
Chemical Name | NA |
Formulation | 20 mg/10 mL |
Physcial Appearance | Aqueous solution |
Route of Administration | Intravenous infusion |
Recommended Dosage | The recommended starting dosage is 1 mg/kg administered once weekly as an intravenous infusion. For patients who do not achieve an optimal clinical response, increase to 3 mg/kg once weekly. |
Contraindication | NA |
Side Effects | Diarrhea, vomiting, fever, rhinitis, anemia, cough, nasopharyngitis, urticaria. |
Useful Link | http://www.rxlist.com/kanuma-drug.htm |
PubMed ID | 28197978, 28179030, 27878737, 27876313, 27816062, 27799810, 27649344, 27576533, 27376161 |
3-D Structure | Th1197 (View) or (Download) |