Detailed description page of THPdb

This page displays user query in tabular form.

Th1100 details

Primary information
ID 1482
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S2
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number US5686411
Date of Issue 17/03/03
Date of Expiry 17/03/23
Drug Interaction N.A.
Target Calcitonin receptor,Receptor activity-modifying protein 1,Receptor activity-modifying protein 2,Receptor activity-modifying protein 3
Information of corresponding available drug in the market
Brand Name Symlin
Company Amylin Pharmaceuticals (now a wholly owned subsidiary of AstraZeneca)
Brand Discription SYMLIN (pramlintide acetate) injection is an anti-diabetic medication for use in patients with diabetes treated with insulin. Pramlintide is a synthetic analog of human amylin, a naturally occurring neuroendocrine hormone synthesized by pancreatic beta cells that contributes to glucose control during the postprandial period. Pramlintide is provided as an acetate salt of the synthetic 37-amino acid polypeptide, which differs in amino acid sequence from human amylin by replacement with proline at positions 25 (alanine), 28 (serine), and 29 (serine). The structural formula of pramlintide acetate is shown below: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-AsnAsn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate (salt) with a disulfide bridge between the two Cys residues. Pramlintide acetate is a white powder that has a molecular formula of C171H267N51O53S2â€¢ Ã— C2H4O2 (3 â‰¤ Ã— â‰¤ 8); the molecular weight is 3949.4. Pramlintide acetate is soluble in water.
Prescribed for SYMLIN is indicated as an adjunctive treatment in patients with type 1 or type 2 diabetes who use mealtime insulin therapy and who have failed to achieve desired glucose control despite optimal insulin therapy.
Chemical Name N.A.
Formulation The disposable multidose SymlinPen pen-injector contains 1000 mcg/mL of pramlintide (as acetate). The formulation contains 2.25 mg/mL of metacresol as a preservative, D-mannitol as a tonicity modifier, acetic acid, sodium acetate as pH modifiers, and water for injection. SYMLIN has a pH of approximately 4.0
Physcial Appearance Clear, isotonic, sterile solution for subcutaneous administration
Route of Administration Subcutaneous
Recommended Dosage Reduce mealtime insulin doses by 50%, then initiate SYMLIN at 15 mcg subcutaneously, injecting immediately prior to each major meal. Increase the SYMLIN dose to the next increment (30, 45, or 60 mcg) when no clinically significant nausea has occurred for at least 3 days. If significant nausea persists at the 45 or 60 mcg dose level, the SYMLIN dose should be decreased to 30 mcg. If the 30 mcg dose is not tolerated, discontinuation of SYMLIN therapy should be considered.
Contraindication N.A.
Side Effects Nausea, Anorexia, Vomiting, Arthralgia, Fatigue, Allergic Reaction, Dizziness
Useful Link http://www.symlin.com/ http://www.rxlist.com/symlin-drug.htm http://www.drugs.com/pro/symlin.html http://diabetes.emedtv.com/symlin/symlin.html
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1483
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S3
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number US6610824
Date of Issue 04/03/98
Date of Expiry 04/03/15
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1484
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S4
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1485
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S5
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1486
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S6
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1487
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S7
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1488
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S8
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1489
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S9
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1490
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S10
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1491
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S11
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1492
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S12
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

Primary information
ID 1493
ThPP ID Th1100
Therapeutic Peptide/Protein Name Pramlintide
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification Ia
Molecular Weight 3949.3896
Chemical Formula C171H267N51O53S13
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life Approximately 48 minutes
Description New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity N.A.
Metabolism Metabolized primarily by the kidneys.
Absorption The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18998755, 17619527, 16330288, 12841822
3-D Structure Th1100 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1482
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S2
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	US5686411
Date of Issue	17/03/03
Date of Expiry	17/03/23
Drug Interaction	N.A.
Target	Calcitonin receptor,Receptor activity-modifying protein 1,Receptor activity-modifying protein 2,Receptor activity-modifying protein 3
Information of corresponding available drug in the market
Brand Name	Symlin
Company	Amylin Pharmaceuticals (now a wholly owned subsidiary of AstraZeneca)
Brand Discription	SYMLIN (pramlintide acetate) injection is an anti-diabetic medication for use in patients with diabetes treated with insulin. Pramlintide is a synthetic analog of human amylin, a naturally occurring neuroendocrine hormone synthesized by pancreatic beta cells that contributes to glucose control during the postprandial period. Pramlintide is provided as an acetate salt of the synthetic 37-amino acid polypeptide, which differs in amino acid sequence from human amylin by replacement with proline at positions 25 (alanine), 28 (serine), and 29 (serine). The structural formula of pramlintide acetate is shown below: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-AsnAsn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate (salt) with a disulfide bridge between the two Cys residues. Pramlintide acetate is a white powder that has a molecular formula of C171H267N51O53S2â€¢ Ã— C2H4O2 (3 â‰¤ Ã— â‰¤ 8); the molecular weight is 3949.4. Pramlintide acetate is soluble in water.
Prescribed for	SYMLIN is indicated as an adjunctive treatment in patients with type 1 or type 2 diabetes who use mealtime insulin therapy and who have failed to achieve desired glucose control despite optimal insulin therapy.
Chemical Name	N.A.
Formulation	The disposable multidose SymlinPen pen-injector contains 1000 mcg/mL of pramlintide (as acetate). The formulation contains 2.25 mg/mL of metacresol as a preservative, D-mannitol as a tonicity modifier, acetic acid, sodium acetate as pH modifiers, and water for injection. SYMLIN has a pH of approximately 4.0
Physcial Appearance	Clear, isotonic, sterile solution for subcutaneous administration
Route of Administration	Subcutaneous
Recommended Dosage	Reduce mealtime insulin doses by 50%, then initiate SYMLIN at 15 mcg subcutaneously, injecting immediately prior to each major meal. Increase the SYMLIN dose to the next increment (30, 45, or 60 mcg) when no clinically significant nausea has occurred for at least 3 days. If significant nausea persists at the 45 or 60 mcg dose level, the SYMLIN dose should be decreased to 30 mcg. If the 30 mcg dose is not tolerated, discontinuation of SYMLIN therapy should be considered.
Contraindication	N.A.
Side Effects	Nausea, Anorexia, Vomiting, Arthralgia, Fatigue, Allergic Reaction, Dizziness
Useful Link	http://www.symlin.com/ http://www.rxlist.com/symlin-drug.htm http://www.drugs.com/pro/symlin.html http://diabetes.emedtv.com/symlin/symlin.html
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1483
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S3
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	US6610824
Date of Issue	04/03/98
Date of Expiry	04/03/15
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1484
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S4
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1485
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S5
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1486
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S6
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1487
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S7
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1488
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S8
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1489
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S9
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1490
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S10
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1491
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S11
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1492
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S12
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Primary information
ID	1493
ThPP ID	Th1100
Therapeutic Peptide/Protein Name	Pramlintide
Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	3949.3896
Chemical Formula	C171H267N51O53S13
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	Approximately 48 minutes
Description	New adjunct treatment for type I and type II diabetes. It is developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone released after meal, in a pattern similar to insulin. Diabetic patients are also deficient in amylin.
Indication/Disease	For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Pharmacodynamics	Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic ÃŽÂ²-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of Action	Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Toxicity	N.A.
Metabolism	Metabolized primarily by the kidneys.
Absorption	The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18998755, 17619527, 16330288, 12841822
3-D Structure	Th1100 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb