| Mechanism of Action | Serum albumin acts as a high molecular weight, very soluble osmolyte. Serum albumin also acts as a protein drug carrier in plasma, and transports hemin, steroids, thyroid hormones and fatty acids. It binds many other substances, such as unconjugated bilirubin, calcium ions, and other fat soluble hormones. |
| Brand Discription | Albumin is used to replace blood volume loss resulting from trauma such as a severe burns or an injury that causes blood loss. This medicine is also used to treat low albumin levels caused by surgery, dialysis, abdominal infections, liver failure, pancreatitis, respiratory distress, bypass surgery, ovarian problems caused by fertility drugs, and other many other conditions. |
| Primary information |
|---|
| ID | 1446 |
| ThPP ID | Th1079 |
| Therapeutic Peptide/Protein Name | Serum albumin |
| Sequence | DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFA view full sequnce in fasta |
| Functional Classification | IV |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | Suspension of microspheres of human serum albumin with perflutren. Perflutren is a highly fluorinated small molecule, used to enhance contrast for ultrasound imaging procedures |
| Indication/Disease | For treatment of severe blood loss, hypervolemia, hypoproteinemia. |
| Pharmacodynamics | Serum albumin is a soluble, monomeric protein necessary for maintaining and regulating the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentration and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Serum albumin acts as a high molecular weight, very soluble osmolyte. Serum albumin also acts as a protein drug carrier in plasma, and transports hemin, steroids, thyroid hormones and fatty acids. It binds many other substances, such as unconjugated bilirubin, calcium ions, and other fat soluble hormones. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Serum substitutes |
| Patents Number | US5558094 |
| Date of Issue | 01/03/99 |
| Date of Expiry | 29/02/16 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Optison |
| Company | GE Healthcare |
| Brand Discription | Optison (Perflutren Protein-Type A Microspheres Injectable Suspension, USP) is a sterile non-pyrogenic suspension of microspheres of human serum albumin with perflutren for contrast enhancement during the indicated ultrasound imaging procedures. The vial contains a clear liquid lower layer and a white upper layer that, after resuspension by gentle mixing, provides a homogeneous, opaque, milky-white suspension for Intravenous infusion. Perflutren is chemically characterized as 1,1,1,2,2,3,3,3-perflutren with a molecular weight of 188, an empirical formula of C3F8. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | Optison (Perflutren Protein-Type A Microspheres Injectable Suspension, USP) is available in a carton of five 3 mL fills in single use 3 mL vials. Each mL of Optison contains 5.0-8.0×108 protein-type A microspheres, 10 mg Albumin Human, USP, 0.22 ± 0.11 mg/mL perflutren, 0.2 mg N-acetyltryptophan, and 0.12 mg caprylic acid in 0.9% aqueous sodium chloride. The headspace of the vial is filled with perflutren gas. The pH is adjusted to 6.4-7.4. The protein in the microsphere shell makes up approximately 5-7% (w/w) of the total protein in the liquid. |
| Physcial Appearance | N.A. |
| Route of Administration | Intravenous |
| Recommended Dosage | N.A. |
| Contraindication | Right-to-left, bi-directional, or transient right-to-left cardiac shunts, Hypersensitivity to perflutren, blood, blood products or albumin. Do not administer Optison by intra-arterial injection. This product contains albumin, a derivative of human blood. Based on effective donor screening and product manufacturing processes, it carries an extremely remote risk for transmission of viral disease. A theoretical risk for transmission of Creutzfeldt-Jakob disease (CJD) also is considered extremely remote. No cases of transmission of viral disease or CJD have ever been identified for albumin. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 25895349, 25755577, 12846933, 9675210, 17667792 |
| 3-D Structure | Th1079 (View) or (Download) |