Detailed description page of THPdb

This page displays user query in tabular form.

Th1074 details

Primary information
ID 1433
ThPP ID Th1074
Therapeutic Peptide/Protein Name Alglucerase
Sequence ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRME view full sequnce in fasta
Functional Classification Ia
Molecular Weight 55597.4
Chemical Formula C2532H3854N672O711S16
Isoelectric Point 7.41
Hydrophobicity -0.168
Melting Point (℃) N.A.
Half Life 3.6-10.4 min
Description Human Beta-glucocerebrosidase or Beta-D-glucosyl-N-acylsphingosine glucohydrolase E.C. 3.2.1.45. 497 residue protein with N-linked carbohydrates. Alglucerase is prepared by modification of the oligosaccharide chains of human Beta-glucocerebrosidase. The modification alters the sugar residues at the non-reducing ends of the oligosaccharide chains of the glycoprotein so that they are predominantly terminated with mannose residues
Indication/Disease For the treatment of Gaucher's disease (deficiency in glucocerebrosidase)
Pharmacodynamics Gaucher disease is characterized by a functional deficiency in Beta-glucocerebrosidase enzymatic activity and the resultant accumulation of lipid glucocerebroside in tissue macrophages which become engorged and are termed Gaucher cells. Gaucher cells are typically found in liver, spleen and bone marrow. This can lead to an enlarged spleen and liver (hepatosplenomegaly). Secondary hematologic sequelae include severe anemia and thrombocytopenia. Injections of alglucerase into Gaucher disease patients leads to elevated serum levels of the enzyme and reduction in the accumulation of glucocerebroside
Mechanism of Action Alglucerase catalyzes the hydrolysis of the glycolipid, glucocerebroside, to glucose and ceramide as part of the normal degradation pathway for membrane lipids.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 49.4 to 282.1 mL/kg
Clearance N.A.
Categories Enzyme Replacement Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target Plasminogen,Proteinase-activated receptor 1
Information of corresponding available drug in the market
Brand Name Ceredase
Company Genzyme Corporation
Brand Discription Ceredase (alglucerase injection) is a modified form of the enzyme, Î²-glucocerebrosidase (Î²-Dglucosyl-N-acylsphingosine glucohydrolase, ECÂ
Prescribed for Ceredase (alglucerase injection) is indicated for use as long-term enzyme replacement therapy for children, adolescents and adult patients with a confirmed diagnosis of Type I Gaucher disease who exhibit signs and symptoms that are severe enough to result in moderate-to-severe anemia, thrombocytopenia with bleeding tendency, bone disease, significant hepatomegaly or splenomegaly.
Chemical Name N.A.
Formulation Ceredase citrate is supplied as buffered solution (53 mM citrate, 143 mM sodium) containing 1% albumin human USP. The enzyme is supplied in one concentration, 400 units per bottle (80 units/mL) with a fill volume of 5 mL per bottle. An enzyme unit (U) is defined as the amount of enzyme required to hydrolyze in one minute one micromole of the synthetic substrate, p-nitrophenyl-Î²-D-glucopyranoside.
Physcial Appearance Ceredase (alglucerase injection) is supplied as a clear sterile non-pyrogenic solution of alglucerase in a citrate buffered solution
Route of Administration Intravenous infusion
Recommended Dosage Ceredase (alglucerase injection) is administered by Intravenous infusion over 1-2 hours. Dosage should be individualized for each patient. Initial dosage may be as little as 2.5 units/kg of body weight 3 times a week up to as much as 60 units/kg administered as frequently as once a week or as infrequently as every 4 weeks. 60 units/kg every 2 weeks is the dose for which the most data are available. Disease severity may dictate that drug be initiated with relatively high doses or relatively frequent administration. After patient response is well-established, a reduction in dosage may be attempted forÂ maintenance therapy. Progressive reductions can be made at intervals of 3-6 months while carefully monitoring response parameters.
Contraindication There are no known contraindications to the use of Ceredase (alglucerase injection).
Side Effects Events were related to the route of administration including discomfort,pruritus, burning and swelling or sterileÂ abscessÂ at the site ofÂ venipuncture. The remaining experiences consisted of slightÂ fever, chills,Â abdominaldiscomfort,Â nauseaÂ or vomiting. Additional adverse symptoms which have been reported include: fatigue, vasomotor irritability or hot flash, weakness, headache, light headedness, dysosmia, oral ulcerations, backache and transient peripheral edema, and diarrhea. Menstrual abnormalities and false positive pregnancy tests
Useful Link http://www.rxlist.com/ceredase-drug.htm
PubMed ID 19265748
3-D Structure Th1074 (View) or (Download)

Primary information
ID 1434
ThPP ID Th1074
Therapeutic Peptide/Protein Name Alglucerase
Sequence ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRME view full sequnce in fasta
Functional Classification Ia
Molecular Weight 55597.4
Chemical Formula C2532H3854N672O711S16
Isoelectric Point 7.41
Hydrophobicity -0.168
Melting Point (℃) N.A.
Half Life 3.6-10.4 min
Description Human Beta-glucocerebrosidase or Beta-D-glucosyl-N-acylsphingosine glucohydrolase E.C. 3.2.1.45. 497 residue protein with N-linked carbohydrates. Alglucerase is prepared by modification of the oligosaccharide chains of human Beta-glucocerebrosidase. The modification alters the sugar residues at the non-reducing ends of the oligosaccharide chains of the glycoprotein so that they are predominantly terminated with mannose residues
Indication/Disease For the treatment of Gaucher's disease (deficiency in glucocerebrosidase)
Pharmacodynamics Gaucher disease is characterized by a functional deficiency in Beta-glucocerebrosidase enzymatic activity and the resultant accumulation of lipid glucocerebroside in tissue macrophages which become engorged and are termed Gaucher cells. Gaucher cells are typically found in liver, spleen and bone marrow. This can lead to an enlarged spleen and liver (hepatosplenomegaly). Secondary hematologic sequelae include severe anemia and thrombocytopenia. Injections of alglucerase into Gaucher disease patients leads to elevated serum levels of the enzyme and reduction in the accumulation of glucocerebroside
Mechanism of Action Alglucerase catalyzes the hydrolysis of the glycolipid, glucocerebroside, to glucose and ceramide as part of the normal degradation pathway for membrane lipids.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 49.4 to 282.1 mL/kg
Clearance N.A.
Categories Enzyme Replacement Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 19265748
3-D Structure Th1074 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1433
ThPP ID	Th1074
Therapeutic Peptide/Protein Name	Alglucerase
Sequence	ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRME view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	55597.4
Chemical Formula	C2532H3854N672O711S16
Isoelectric Point	7.41
Hydrophobicity	-0.168
Melting Point (℃)	N.A.
Half Life	3.6-10.4 min
Description	Human Beta-glucocerebrosidase or Beta-D-glucosyl-N-acylsphingosine glucohydrolase E.C. 3.2.1.45. 497 residue protein with N-linked carbohydrates. Alglucerase is prepared by modification of the oligosaccharide chains of human Beta-glucocerebrosidase. The modification alters the sugar residues at the non-reducing ends of the oligosaccharide chains of the glycoprotein so that they are predominantly terminated with mannose residues
Indication/Disease	For the treatment of Gaucher's disease (deficiency in glucocerebrosidase)
Pharmacodynamics	Gaucher disease is characterized by a functional deficiency in Beta-glucocerebrosidase enzymatic activity and the resultant accumulation of lipid glucocerebroside in tissue macrophages which become engorged and are termed Gaucher cells. Gaucher cells are typically found in liver, spleen and bone marrow. This can lead to an enlarged spleen and liver (hepatosplenomegaly). Secondary hematologic sequelae include severe anemia and thrombocytopenia. Injections of alglucerase into Gaucher disease patients leads to elevated serum levels of the enzyme and reduction in the accumulation of glucocerebroside
Mechanism of Action	Alglucerase catalyzes the hydrolysis of the glycolipid, glucocerebroside, to glucose and ceramide as part of the normal degradation pathway for membrane lipids.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	49.4 to 282.1 mL/kg
Clearance	N.A.
Categories	Enzyme Replacement Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	Plasminogen,Proteinase-activated receptor 1
Information of corresponding available drug in the market
Brand Name	Ceredase
Company	Genzyme Corporation
Brand Discription	Ceredase (alglucerase injection) is a modified form of the enzyme, Î²-glucocerebrosidase (Î²-Dglucosyl-N-acylsphingosine glucohydrolase, ECÂ
Prescribed for	Ceredase (alglucerase injection) is indicated for use as long-term enzyme replacement therapy for children, adolescents and adult patients with a confirmed diagnosis of Type I Gaucher disease who exhibit signs and symptoms that are severe enough to result in moderate-to-severe anemia, thrombocytopenia with bleeding tendency, bone disease, significant hepatomegaly or splenomegaly.
Chemical Name	N.A.
Formulation	Ceredase citrate is supplied as buffered solution (53 mM citrate, 143 mM sodium) containing 1% albumin human USP. The enzyme is supplied in one concentration, 400 units per bottle (80 units/mL) with a fill volume of 5 mL per bottle. An enzyme unit (U) is defined as the amount of enzyme required to hydrolyze in one minute one micromole of the synthetic substrate, p-nitrophenyl-Î²-D-glucopyranoside.
Physcial Appearance	Ceredase (alglucerase injection) is supplied as a clear sterile non-pyrogenic solution of alglucerase in a citrate buffered solution
Route of Administration	Intravenous infusion
Recommended Dosage	Ceredase (alglucerase injection) is administered by Intravenous infusion over 1-2 hours. Dosage should be individualized for each patient. Initial dosage may be as little as 2.5 units/kg of body weight 3 times a week up to as much as 60 units/kg administered as frequently as once a week or as infrequently as every 4 weeks. 60 units/kg every 2 weeks is the dose for which the most data are available. Disease severity may dictate that drug be initiated with relatively high doses or relatively frequent administration. After patient response is well-established, a reduction in dosage may be attempted forÂ maintenance therapy. Progressive reductions can be made at intervals of 3-6 months while carefully monitoring response parameters.
Contraindication	There are no known contraindications to the use of Ceredase (alglucerase injection).
Side Effects	Events were related to the route of administration including discomfort,pruritus, burning and swelling or sterileÂ abscessÂ at the site ofÂ venipuncture. The remaining experiences consisted of slightÂ fever, chills,Â abdominaldiscomfort,Â nauseaÂ or vomiting. Additional adverse symptoms which have been reported include: fatigue, vasomotor irritability or hot flash, weakness, headache, light headedness, dysosmia, oral ulcerations, backache and transient peripheral edema, and diarrhea. Menstrual abnormalities and false positive pregnancy tests
Useful Link	http://www.rxlist.com/ceredase-drug.htm
PubMed ID	19265748
3-D Structure	Th1074 (View) or (Download)

Primary information
ID	1434
ThPP ID	Th1074
Therapeutic Peptide/Protein Name	Alglucerase
Sequence	ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRME view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	55597.4
Chemical Formula	C2532H3854N672O711S16
Isoelectric Point	7.41
Hydrophobicity	-0.168
Melting Point (℃)	N.A.
Half Life	3.6-10.4 min
Description	Human Beta-glucocerebrosidase or Beta-D-glucosyl-N-acylsphingosine glucohydrolase E.C. 3.2.1.45. 497 residue protein with N-linked carbohydrates. Alglucerase is prepared by modification of the oligosaccharide chains of human Beta-glucocerebrosidase. The modification alters the sugar residues at the non-reducing ends of the oligosaccharide chains of the glycoprotein so that they are predominantly terminated with mannose residues
Indication/Disease	For the treatment of Gaucher's disease (deficiency in glucocerebrosidase)
Pharmacodynamics	Gaucher disease is characterized by a functional deficiency in Beta-glucocerebrosidase enzymatic activity and the resultant accumulation of lipid glucocerebroside in tissue macrophages which become engorged and are termed Gaucher cells. Gaucher cells are typically found in liver, spleen and bone marrow. This can lead to an enlarged spleen and liver (hepatosplenomegaly). Secondary hematologic sequelae include severe anemia and thrombocytopenia. Injections of alglucerase into Gaucher disease patients leads to elevated serum levels of the enzyme and reduction in the accumulation of glucocerebroside
Mechanism of Action	Alglucerase catalyzes the hydrolysis of the glycolipid, glucocerebroside, to glucose and ceramide as part of the normal degradation pathway for membrane lipids.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	49.4 to 282.1 mL/kg
Clearance	N.A.
Categories	Enzyme Replacement Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	19265748
3-D Structure	Th1074 (View) or (Download)