Detailed description page of THPdb

This page displays user query in tabular form.

Th1062 details

Primary information
ID 1389
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 61 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number CA2149329
Date of Issue 16/07/12
Date of Expiry 13/11/17
Drug Interaction Azilsartan medoxomil used in combination with rituximab may lead to hypotension
Target N.A.
Information of corresponding available drug in the market
Brand Name Rituxan
Company Biogen Idec Inc., and Genentech USA, Inc
Brand Discription Rituxan (rituximab) is a genetically engineered chimeric murine/humanmonoclonalÂ IgG1 kappa antibody directed against the CD20Â antigen. Rituximab has an approximate molecular weight of 145 kD. Rituximab has a bindingÂ affinityÂ for the CD20 antigen of approximately 8.0 nM. Rituximab is produced by mammalian cell (Chinese Hamster Ovary) suspension culture in a nutrient medium containing the antibiotic gentamicin. Gentamicin is not detectable in the final product.
Prescribed for used in Nonâ€“Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia (CLL), Rheumatoid Arthritis (RA), Granulomatosis with Polyangiitis (GPA) (Wegener's Granulomatosis) and Microscopic Polyangiitis (MPA)
Chemical Name N.A.
Formulation Rituxan is supplied at a concentration of 10 mg/mL in either 100 mg/10 mL or 500 mg/50 mL single-use vials. The product is formulated in polysorbate 80 (0.7 mg/mL), sodium citrate dihydrate (7.35 mg/mL), sodium chloride (9 mg/mL) and Water for Injection. The pH is 6.5.
Physcial Appearance Rituxan is a Sterile, clear, colorless, preservative-free liquid concentrate
Route of Administration Â Intravenous administration
Recommended Dosage Initiate infusion at a rate of 50 mg/hr. In the absence of infusion toxicity, increase infusion rate by 50 mg/hr increments every 30 minutes, to a maximum of 400 mg/hr. In NHL the recommended dose is 375 mg/m2 as an Intravenous infusion. In CLL 375 mg/m2 the day prior to the initiation of FC chemotherapy, then 500 mg/m2 on Day 1 of cycles 2â€“6 (every 28 days). Administer Rituxan as two-1000 mg Intravenous infusions separated by 2 weeks. Administer Rituxan as a 375 mg/m2 Intravenous infusion once weekly for 4 weeks.
Contraindication none
Side Effects Infusion reactions, Mucocutaneous reactions, Hepatitis B reactivation with fulminant hepatitis, Progressive multifocal leukoencephalopathy , Tumor lysis syndrome , Infections, Cardiac arrhythmias, Renal toxicity, Bowel obstruction and perforation
Useful Link http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=b172773b-3905-4a1c-ad95-bab4b6126563 http://www.rxlist.com/rituxan-drug.htm
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1390
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 62 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number CA1336826
Date of Issue 30/08/99
Date of Expiry 30/08/16
Drug Interaction Betaxolol, Chlorothiazide may enhance the hypotensive effect of rituximab. Consider temporarily withholding antihypertensive medications for 12 hours prior to rituximab infusion to avoid excessive hypotension during or immediately after infusion
Target Receptor tyrosine-protein kinase erbB-2,Epidermal growth factor receptor,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Complement C1s subcomponent,High affinity immunoglobulin gamma Fc receptor I,Low affinity immunoglobulin gamma Fc region receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-b,Low affinity immunoglobulin gamma Fc region receptor II-c,Low affinity immunoglobulin gamma Fc region receptor III-B,Low affinity immunoglobulin gamma Fc region receptor III-A
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1391
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 63 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number US5736137
Date of Issue 08/04/02
Date of Expiry 08/04/19
Drug Interaction Certolizumab pegol Co-administration with trastuzumab may increase the risk of serious infections. Concomitant therapy is not recommended
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1392
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 64 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Telmisartan may increase the hypotensive effect of Rituximab. Telmisartan should be withheld prior to and throughout Rituximab administration
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1393
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 65 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Terazosin, Torasemide, Trichlormethiazide causes additive antihypertensive effects may occur. Increased risk of hypotension. Consider withholding drug for 12 hours prior to administration of Rituximab
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1394
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 66 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Tofacitinib avoid combination due to the potential increase in tofacitinib related adverse effects
Target B-lymphocyte antigen CD20,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamma Fc region receptor III-A,Complement C1s subcomponent,High affinity immunoglobulin gamma Fc receptor I,Low affinity immunoglobulin gamma Fc region receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-b,Low affinity immunoglobulin gamma Fc region receptor II-c
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1395
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 67 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Tolazamide, Valsartan, Verapamil causes additive hypotensive effects . Consider withholding drug for 12 hours prior to administration of Rituximab
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1396
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 68 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Trandolapril may increase the hypotensive effect of Rituximab
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

Primary information
ID 1397
ThPP ID Th1062
Therapeutic Peptide/Protein Name Rituximab
Sequence Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification IIa
Molecular Weight 143859.7
Chemical Formula C6416H9874N1688O1987S44
Isoelectric Point 8.68
Hydrophobicity -0.414
Melting Point (℃) 69 (FAB f
Half Life 0.8 hours (mammalian reticulocytes, in vitro)
Description Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 3.1 L
Clearance 0.34 L/day [RA patients]
Categories Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure Th1062 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1389
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	61 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	CA2149329
Date of Issue	16/07/12
Date of Expiry	13/11/17
Drug Interaction	Azilsartan medoxomil used in combination with rituximab may lead to hypotension
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Rituxan
Company	Biogen Idec Inc., and Genentech USA, Inc
Brand Discription	Rituxan (rituximab) is a genetically engineered chimeric murine/humanmonoclonalÂ IgG1 kappa antibody directed against the CD20Â antigen. Rituximab has an approximate molecular weight of 145 kD. Rituximab has a bindingÂ affinityÂ for the CD20 antigen of approximately 8.0 nM. Rituximab is produced by mammalian cell (Chinese Hamster Ovary) suspension culture in a nutrient medium containing the antibiotic gentamicin. Gentamicin is not detectable in the final product.
Prescribed for	used in Nonâ€“Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia (CLL), Rheumatoid Arthritis (RA), Granulomatosis with Polyangiitis (GPA) (Wegener's Granulomatosis) and Microscopic Polyangiitis (MPA)
Chemical Name	N.A.
Formulation	Rituxan is supplied at a concentration of 10 mg/mL in either 100 mg/10 mL or 500 mg/50 mL single-use vials. The product is formulated in polysorbate 80 (0.7 mg/mL), sodium citrate dihydrate (7.35 mg/mL), sodium chloride (9 mg/mL) and Water for Injection. The pH is 6.5.
Physcial Appearance	Rituxan is a Sterile, clear, colorless, preservative-free liquid concentrate
Route of Administration	Â Intravenous administration
Recommended Dosage	Initiate infusion at a rate of 50 mg/hr. In the absence of infusion toxicity, increase infusion rate by 50 mg/hr increments every 30 minutes, to a maximum of 400 mg/hr. In NHL the recommended dose is 375 mg/m2 as an Intravenous infusion. In CLL 375 mg/m2 the day prior to the initiation of FC chemotherapy, then 500 mg/m2 on Day 1 of cycles 2â€“6 (every 28 days). Administer Rituxan as two-1000 mg Intravenous infusions separated by 2 weeks. Administer Rituxan as a 375 mg/m2 Intravenous infusion once weekly for 4 weeks.
Contraindication	none
Side Effects	Infusion reactions, Mucocutaneous reactions, Hepatitis B reactivation with fulminant hepatitis, Progressive multifocal leukoencephalopathy , Tumor lysis syndrome , Infections, Cardiac arrhythmias, Renal toxicity, Bowel obstruction and perforation
Useful Link	http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=b172773b-3905-4a1c-ad95-bab4b6126563 http://www.rxlist.com/rituxan-drug.htm
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1390
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	62 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	CA1336826
Date of Issue	30/08/99
Date of Expiry	30/08/16
Drug Interaction	Betaxolol, Chlorothiazide may enhance the hypotensive effect of rituximab. Consider temporarily withholding antihypertensive medications for 12 hours prior to rituximab infusion to avoid excessive hypotension during or immediately after infusion
Target	Receptor tyrosine-protein kinase erbB-2,Epidermal growth factor receptor,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Complement C1s subcomponent,High affinity immunoglobulin gamma Fc receptor I,Low affinity immunoglobulin gamma Fc region receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-b,Low affinity immunoglobulin gamma Fc region receptor II-c,Low affinity immunoglobulin gamma Fc region receptor III-B,Low affinity immunoglobulin gamma Fc region receptor III-A
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1391
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	63 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	US5736137
Date of Issue	08/04/02
Date of Expiry	08/04/19
Drug Interaction	Certolizumab pegol Co-administration with trastuzumab may increase the risk of serious infections. Concomitant therapy is not recommended
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1392
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	64 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Telmisartan may increase the hypotensive effect of Rituximab. Telmisartan should be withheld prior to and throughout Rituximab administration
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1393
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	65 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Terazosin, Torasemide, Trichlormethiazide causes additive antihypertensive effects may occur. Increased risk of hypotension. Consider withholding drug for 12 hours prior to administration of Rituximab
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1394
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	66 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Tofacitinib avoid combination due to the potential increase in tofacitinib related adverse effects
Target	B-lymphocyte antigen CD20,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamma Fc region receptor III-A,Complement C1s subcomponent,High affinity immunoglobulin gamma Fc receptor I,Low affinity immunoglobulin gamma Fc region receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-b,Low affinity immunoglobulin gamma Fc region receptor II-c
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1395
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	67 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Tolazamide, Valsartan, Verapamil causes additive hypotensive effects . Consider withholding drug for 12 hours prior to administration of Rituximab
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1396
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	68 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Trandolapril may increase the hypotensive effect of Rituximab
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)

Primary information
ID	1397
ThPP ID	Th1062
Therapeutic Peptide/Protein Name	Rituximab
Sequence	Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	143859.7
Chemical Formula	C6416H9874N1688O1987S44
Isoelectric Point	8.68
Hydrophobicity	-0.414
Melting Point (℃)	69 (FAB f
Half Life	0.8 hours (mammalian reticulocytes, in vitro)
Description	Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids.
Indication/Disease	For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
Pharmacodynamics	Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of Action	The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	3.1 L
Clearance	0.34 L/day [RA patients]
Categories	Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272
3-D Structure	Th1062 (View) or (Download)