Detailed description page of THPdb

This page displays user query in tabular form.

Th1051 details

Primary information
ID 1361
ThPP ID Th1051
Therapeutic Peptide/Protein Name Human Serum Albumin
Sequence MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification Ia
Molecular Weight 66472.2
Chemical Formula C2936H4624N786O889S41
Isoelectric Point 5.67
Hydrophobicity -0.395
Melting Point (℃) 62
Half Life N.A.
Description Human serum albumin isolated from expired blood plasma.
Indication/Disease Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia.
Pharmacodynamics Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action Human Serum albumin acts as a high molecular weight, very soluble osmolyte.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Serum substitutes
Patents Number US6723303
Date of Issue 21/04/05
Date of Expiry 21/04/25
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Albuminar
Company CSL Behring
Brand Discription AlbuminarÂ is a sterile aqueous solution of albumin obtained from large pools of adult human venousÂ plasmaby low temperature controlled fractionation according to the Cohn process. It is stabilized with 0.02 MÂ sodiumÂ acetyltryptophanate and 0.02 M sodium caprylate and pasteurized at 60 for 10 hours.
Prescribed for precscribed in treatment of Shock, Burns, Hypoproteinemia with or without edema
Chemical Name N.A.
Formulation Albumin (Human) 25% (albumin human) is a solution containing in each 100 mL, 25 grams of serum albumin, osmotically equivalent to 500 mL of normal human plasma. The pH of the solution is adjusted with sodium bicarbonate, sodium hydroxide, or acetic acid. Approximate concentrations of significant electrolytes per liter are: sodium - 130-160 mEq; and potassium - n.m.t. 1 mEq.
Physcial Appearance Albumin (Human) 25%, is a Sterile aqueous solution of albumin obtained from large pools of adult human venous plasma by low temperature controlled fractionation according to the Cohn process.
Route of Administration Albumin (Human) 25%, Albuminar-25 (albumin human)
Recommended Dosage Albumin (Human) 25%, Albuminar-25 (albumin (human)) may be given intravenously without dilution or it may be diluted with normal saline or 5% dextrose before administration. 200 mL per liter gives a solution which is approximately isotonic and iso-osmotic with citrated plasma.
Contraindication Albumin (Human) 25% may be contraindicated in patients with severe anemia or cardiac failure and in patients with a history of allergic reactions to human albumin.
Side Effects Allergic or pyrogenic reactions are characterized primarily by fever and chills; rash, nausea, vomiting, tachycardia and hypotension have also been reported. if administered rapidly, may result in vascular overload with resultant pulmonary edema.
Useful Link http://www.rxlist.com/albuminar-drug.htm
PubMed ID 12846933, 9675210
3-D Structure Th1051 (View) or (Download)

Primary information
ID 1362
ThPP ID Th1051
Therapeutic Peptide/Protein Name Human Serum Albumin
Sequence MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification Ia
Molecular Weight 66472.2
Chemical Formula C2936H4624N786O889S41
Isoelectric Point 5.67
Hydrophobicity -0.395
Melting Point (℃) 62
Half Life N.A.
Description Human serum albumin isolated from expired blood plasma.
Indication/Disease Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia.
Pharmacodynamics Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action Human Serum albumin acts as a high molecular weight, very soluble osmolyte.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Serum substitutes
Patents Number US5558094
Date of Issue 01/03/99
Date of Expiry 29/02/16
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Albutein
Company GRIFOLS
Brand Discription Albutein is a concentrate of plasma proteins from human blood. It works by increasing plasma volume or serum albumin levels.
Prescribed for For treatment of hypovolemic shock,As an adjunct in hemodialysis for patients undergoing long-term dialysis or for those patients who are fluid-overloaded and cannot tolerate substantial volumes of salt solution for therapy of shock or hypotension
Chemical Name N.A.
Formulation AlbuteinÂ 20% is clinically desirable, compatible diluents include sterile 0.9% Sodium Chloride solution or sterile 5% Dextrose in Water.
Physcial Appearance AlbuteinÂ 20% is a Sterile, aqueous solution for single dose intravenous administration containing 20% human albumin (weight/volume).
Route of Administration Albutein 20% is to be administered by the Intraven
Recommended Dosage AlbuteinÂ 20% is administered intravenously. The total dosage will vary with the individual. In adults, an initial infusion of 100 mL is suggested.Â
Contraindication AlbuteinÂ 20% is contraindicated in patients with severe anemia or cardiac failure in the presence of normal or increased intravascular volume.
Side Effects The most common adverse reactions include fever and chills, rash, nausea, vomiting, tachycardia and hypotension. Should an adverse reaction occur, slow or stop the infusion for a short period of time which may result in the disappearance of the symptoms. If administration has been stopped and the patient requires additional AlbuteinÂ 20%, material from a different lot should be used.
Useful Link Peters, T., Jr., Serum Albumin in:Â The Plasma Proteins, 2nd Ed., Putnam F.W. (ed), New York, Academic Press, 1:133-181, 1975. Finlayson, J.S., Albumin Products Semin Thromb Hemo, 6:85-120, 1980.
PubMed ID 12846933, 9675210
3-D Structure Th1051 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1361
ThPP ID	Th1051
Therapeutic Peptide/Protein Name	Human Serum Albumin
Sequence	MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	66472.2
Chemical Formula	C2936H4624N786O889S41
Isoelectric Point	5.67
Hydrophobicity	-0.395
Melting Point (℃)	62
Half Life	N.A.
Description	Human serum albumin isolated from expired blood plasma.
Indication/Disease	Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia.
Pharmacodynamics	Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action	Human Serum albumin acts as a high molecular weight, very soluble osmolyte.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Serum substitutes
Patents Number	US6723303
Date of Issue	21/04/05
Date of Expiry	21/04/25
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Albuminar
Company	CSL Behring
Brand Discription	AlbuminarÂ is a sterile aqueous solution of albumin obtained from large pools of adult human venousÂ plasmaby low temperature controlled fractionation according to the Cohn process. It is stabilized with 0.02 MÂ sodiumÂ acetyltryptophanate and 0.02 M sodium caprylate and pasteurized at 60 for 10 hours.
Prescribed for	precscribed in treatment of Shock, Burns, Hypoproteinemia with or without edema
Chemical Name	N.A.
Formulation	Albumin (Human) 25% (albumin human) is a solution containing in each 100 mL, 25 grams of serum albumin, osmotically equivalent to 500 mL of normal human plasma. The pH of the solution is adjusted with sodium bicarbonate, sodium hydroxide, or acetic acid. Approximate concentrations of significant electrolytes per liter are: sodium - 130-160 mEq; and potassium - n.m.t. 1 mEq.
Physcial Appearance	Albumin (Human) 25%, is a Sterile aqueous solution of albumin obtained from large pools of adult human venous plasma by low temperature controlled fractionation according to the Cohn process.
Route of Administration	Albumin (Human) 25%, Albuminar-25 (albumin human)
Recommended Dosage	Albumin (Human) 25%, Albuminar-25 (albumin (human)) may be given intravenously without dilution or it may be diluted with normal saline or 5% dextrose before administration. 200 mL per liter gives a solution which is approximately isotonic and iso-osmotic with citrated plasma.
Contraindication	Albumin (Human) 25% may be contraindicated in patients with severe anemia or cardiac failure and in patients with a history of allergic reactions to human albumin.
Side Effects	Allergic or pyrogenic reactions are characterized primarily by fever and chills; rash, nausea, vomiting, tachycardia and hypotension have also been reported. if administered rapidly, may result in vascular overload with resultant pulmonary edema.
Useful Link	http://www.rxlist.com/albuminar-drug.htm
PubMed ID	12846933, 9675210
3-D Structure	Th1051 (View) or (Download)

Primary information
ID	1362
ThPP ID	Th1051
Therapeutic Peptide/Protein Name	Human Serum Albumin
Sequence	MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	66472.2
Chemical Formula	C2936H4624N786O889S41
Isoelectric Point	5.67
Hydrophobicity	-0.395
Melting Point (℃)	62
Half Life	N.A.
Description	Human serum albumin isolated from expired blood plasma.
Indication/Disease	Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia.
Pharmacodynamics	Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action	Human Serum albumin acts as a high molecular weight, very soluble osmolyte.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Serum substitutes
Patents Number	US5558094
Date of Issue	01/03/99
Date of Expiry	29/02/16
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Albutein
Company	GRIFOLS
Brand Discription	Albutein is a concentrate of plasma proteins from human blood. It works by increasing plasma volume or serum albumin levels.
Prescribed for	For treatment of hypovolemic shock,As an adjunct in hemodialysis for patients undergoing long-term dialysis or for those patients who are fluid-overloaded and cannot tolerate substantial volumes of salt solution for therapy of shock or hypotension
Chemical Name	N.A.
Formulation	AlbuteinÂ 20% is clinically desirable, compatible diluents include sterile 0.9% Sodium Chloride solution or sterile 5% Dextrose in Water.
Physcial Appearance	AlbuteinÂ 20% is a Sterile, aqueous solution for single dose intravenous administration containing 20% human albumin (weight/volume).
Route of Administration	Albutein 20% is to be administered by the Intraven
Recommended Dosage	AlbuteinÂ 20% is administered intravenously. The total dosage will vary with the individual. In adults, an initial infusion of 100 mL is suggested.Â
Contraindication	AlbuteinÂ 20% is contraindicated in patients with severe anemia or cardiac failure in the presence of normal or increased intravascular volume.
Side Effects	The most common adverse reactions include fever and chills, rash, nausea, vomiting, tachycardia and hypotension. Should an adverse reaction occur, slow or stop the infusion for a short period of time which may result in the disappearance of the symptoms. If administration has been stopped and the patient requires additional AlbuteinÂ 20%, material from a different lot should be used.
Useful Link	Peters, T., Jr., Serum Albumin in:Â The Plasma Proteins, 2nd Ed., Putnam F.W. (ed), New York, Academic Press, 1:133-181, 1975. Finlayson, J.S., Albumin Products Semin Thromb Hemo, 6:85-120, 1980.
PubMed ID	12846933, 9675210
3-D Structure	Th1051 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb