Detailed description page of THPdb

This page displays user query in tabular form.

Th1049 details

Primary information
ID 1341
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories Antineoplastic Agents
Patents Number CA1341604
Date of Issue 04/05/10
Date of Expiry 04/05/27
Drug Interaction N.A.
Target Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Information of corresponding available drug in the market
Brand Name Avonex
Company Biogen Inc
Brand Discription AVONEX is a 166 amino acid glycoprotein with a molecular weight of approximately 22,500 daltons. It is produced by recombinant DNA technology using genetically engineered Chinese Hamster Ovary cells into which the human interferon beta gene has been intro
Prescribed for Avonex is used to treat relapsing multiple sclerosis (MS). This medication will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name N.A.
Formulation AVONEX is avalible as powder vial, Single used prefillled syringe, single used prefilled autoinjector. Each vial of reconstituted AVONEX contains 30 micrograms of interferon beta-1a; 15 mg Albumin (Human), USP; 5.8 mg Sodium Chloride, USP; 5.7 mg Dibasic
Physcial Appearance Lyophilized powder vial, Sterile liquid as single used prefilled syringe and also available as single use prefilled autoinjector.
Route of Administration IntramuSubcutaneousular Injection
Recommended Dosage The recommended dose is 30 micrograms once a week. To reduce the incidence and severity of flu-like symptoms that may occur when initiating AVONEX therapy at a dose of 30 micrograms, AVONEX may be started at a dose of 7.5 micrograms and the dose may beincreased by 7.5 micrograms each week for the next three weeks until the recommended dose of 30 micrograms is achieved.
Contraindication Hypersensitivity
Side Effects Stomach pain; headache, drowsiness; or minor irritation where the injection was given.
Useful Link http://www.avonex.com/
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1342
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories Antiviral Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/avonex-drug.htm
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1343
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories Immunologic Factors
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/avonex.html
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1344
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Betaferon
Company Bayer
Brand Discription Betaferon (interferon beta-1b) is a type of medicine known as an interferon, which is used to treat MS. Interferons are proteins found naturally in the body, which may help boost the immune system and fight infections. Betaferon belongs to a class of medi
Prescribed for Betaferon is indicated for the treatment of patients with a single demyelinating event with an active inflammatory process, if it is severe enough to warrant treatment with intravenous corticosteroids, if alternative diagnoses have been excluded, and if t
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Powder and solvent that are made upto make solution.
Route of Administration Subcutaneous Injection
Recommended Dosage N.A.
Contraindication People with severe depression or thoughts of suicide. People with severe liver disease. Pregnancy. Breastfeeding.
Side Effects Flu-like symptoms such as fever,chills, painful joints, malaise, sweating, headache or muscular pain. These symptoms may be reduced by taking paracetamol or steroidal anti-inflammatory medicines such as ibuprofen.
Useful Link http://www.drugs.com/uk/betaferon.html
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1345
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects In injection site reactions, symptoms can include redness, swelling, discolouration, inflammation and pain. These may be reduced by the use of an auto-injector device.
Useful Link http://www.netdoctor.co.uk/brain-and-nervous-system/medicines/betaferon.html
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1346
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.mssociety.ie/uploads/File/Living%20with%20MS/Treating%20and%20Managing%20MS/MS%20Ireland%20Betaferon_Feb2014.pdf
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1347
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Betaseron
Company Merck
Brand Discription Betaseron (interferon beta-lb) is a purified, sterile, lyophilized protein product produced by recombinant DNA techniques. Interferon beta-1b is manufactured by bacterial fermentation of a strain of Escherichia coli that bears a genetically engineered pla
Prescribed for Betaseron is used to treat relapsing multiple sclerosis (MS). Betaseron will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name N.A.
Formulation Lyophilized Betaseron is a sterile, white to off-white powder, for subcutaneous injection after reconstitution with the diluent supplied (Sodium Chloride, 0.54% Solution). Albumin (Human) USP and Mannitol, USP (15 mg each/vial) are added as stabilizers.
Physcial Appearance Sterile, white to off-white powder
Route of Administration Subcutaneous Injection
Recommended Dosage The recommended starting dose is 0.0625 mg (0.25 mL) subcutaneously every other day, with dose increases over a six week period to the recommended dose of 0.25 mg (1 mL) every other day
Contraindication Betaseron is contraindicated in patients with a history of hypersensitivity to natural or recombinant interferon beta, Albumin (Human).
Side Effects Depressed mood, anxiety, trouble sleeping, restlessness, or thoughts of suicide or hurting yourself; bruising, swelling, oozing, or skin changes where the injection was given; weight changes, pounding heartbeats, feeling too hot or cold; fever, chills, bo
Useful Link https://www.betaseron.com/home
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1348
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Weakness; headache; muscle pain or weakness; sleep problems (insomnia); stomach pain; swelling in your hands or feet; skin rash; or irregular menstrual periods.
Useful Link http://www.rxlist.com/betaseron-drug.htm
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1349
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/betaseron.html
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1350
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Blastoferon
Company Sidus
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1351
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Extavia
Company Novartis
Brand Discription EXTAVIA is a purified, sterile, lyophilized protein product produced by recombinant DNA techniques. Interferon beta-1b is manufactured by bacterial fermentation of a strain of Escherichia coli that bears a genetically engineered plasmid containing the gen
Prescribed for Extavia is used to treat relapsing multiple sclerosis (MS). This medication will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name N.A.
Formulation Each vial contains 0.3 mg of interferon beta-1b. The unit measurement is derived by comparing the antiviral activity of the product to the World Health Organization (WHO) reference standard of recombinant human interferon beta. Mannitol, USP and Albumin (
Physcial Appearance Sterile, white to off-white powder
Route of Administration Subcutaneous Injection
Recommended Dosage The recommended starting dose is 0.0625 mg (0.25 mL) subcutaneously every other day, with dose increases over a six week period to the recommended dose of 0.25 mg (1 mL) every other day.
Contraindication Extavia is contraindicated in patients with a history of hypersensitivity to natural or recombinant interferon beta, Albumin (Human).
Side Effects Depressed mood, anxiety, trouble sleeping, restlessness, or thoughts of suicide or hurting yourself; bruising, swelling, oozing, or skin changes where the injection was given; weight changes, pounding heartbeats, feeling too hot or cold; fever, chills, weating, muscle aches and tiredness.
Useful Link http://www.extavia.com/index.jsp?usertrack.filter_applied=true&NovaId=2935376997531791734
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1352
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Weakness; headache; muscle pain or weakness; sleep problems (insomnia); stomach pain; swelling in your hands or feet; skin rash; or irregular menstrual periods.
Useful Link http://www.rxlist.com/extavia-drug.htm
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1353
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.nationalmssociety.org/Treating-MS/Medications/Extavia
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1354
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/extavia.html
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1355
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Rebif
Company Merck
Brand Discription REBIF (interferon beta-1a) is a purified 166 amino acid glycoprotein with a molecular weight of approximately 22,500 daltons. It is produced by recombinant DNA technology using genetically engineered Chinese Hamster Ovary cells into which the human interf
Prescribed for Rebif is used to treat relapsing multiple sclerosis (MS). This medication will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name N.A.
Formulation Each 0.5 mL (0.5 cc) of REBIF contains either 22 mcg or 44 mcg of interferon beta-1a, 2 mg or 4 mg albumin (human), 27.3 mg mannitol, 0.4 mg sodium acetate, and water for injection. Each 0.2 mL (0.2 cc) of REBIF contains 8.8 mcg of interferon beta-1a, 0.8
Physcial Appearance Sterile solution in a prefilled syringe or REBIF Rebidose autoinjector
Route of Administration Subcutaneous Injection
Recommended Dosage The recommended dose of REBIF is either 22 mcg or 44 mcg injected subcutaneously three times per week. REBIF should be administered, if possible, at the same time (preferably in the late afternoon or evening) on the same three days (e.g., Monday, Wednesday, and Friday) at least 48 hours apart each week.
Contraindication REBIF is contraindicated in patients with a history of hypersensitivity to natural or recombinant interferon beta, human albumin
Side Effects Depressed mood, anxiety, trouble sleeping, restlessness, or thoughts of suicide or hurting yourself; bruising, swelling, oozing, or skin changes where the injection was given; weight changes, pounding heartbeats, feeling too hot or cold; fever, chills.
Useful Link http://www.rebif.com/index
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1356
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Weakness; headache; muscle pain or weakness; sleep problems (insomnia); stomach pain; swelling in your hands or feet; skin rash; or irregular menstrual periods.
Useful Link http://www.rxlist.com/rebif-drug.htm
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

Primary information
ID 1357
ThPP ID Th1049
Therapeutic Peptide/Protein Name Interferon beta-1a
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 20027
Chemical Formula C908H1408N246O252S7
Isoelectric Point 8.93
Hydrophobicity -0.427
Melting Point (℃) N.A.
Half Life 10 hours
Description Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 33-55 L/hour [Healthy SC injection of 60 mcg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/rebif.html
PubMed ID 27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure Th1049 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1341
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	Antineoplastic Agents
Patents Number	CA1341604
Date of Issue	04/05/10
Date of Expiry	04/05/27
Drug Interaction	N.A.
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Information of corresponding available drug in the market
Brand Name	Avonex
Company	Biogen Inc
Brand Discription	AVONEX is a 166 amino acid glycoprotein with a molecular weight of approximately 22,500 daltons. It is produced by recombinant DNA technology using genetically engineered Chinese Hamster Ovary cells into which the human interferon beta gene has been intro
Prescribed for	Avonex is used to treat relapsing multiple sclerosis (MS). This medication will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name	N.A.
Formulation	AVONEX is avalible as powder vial, Single used prefillled syringe, single used prefilled autoinjector. Each vial of reconstituted AVONEX contains 30 micrograms of interferon beta-1a; 15 mg Albumin (Human), USP; 5.8 mg Sodium Chloride, USP; 5.7 mg Dibasic
Physcial Appearance	Lyophilized powder vial, Sterile liquid as single used prefilled syringe and also available as single use prefilled autoinjector.
Route of Administration	IntramuSubcutaneousular Injection
Recommended Dosage	The recommended dose is 30 micrograms once a week. To reduce the incidence and severity of flu-like symptoms that may occur when initiating AVONEX therapy at a dose of 30 micrograms, AVONEX may be started at a dose of 7.5 micrograms and the dose may beincreased by 7.5 micrograms each week for the next three weeks until the recommended dose of 30 micrograms is achieved.
Contraindication	Hypersensitivity
Side Effects	Stomach pain; headache, drowsiness; or minor irritation where the injection was given.
Useful Link	http://www.avonex.com/
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1342
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	Antiviral Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/avonex-drug.htm
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1343
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	Immunologic Factors
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/avonex.html
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1344
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Betaferon
Company	Bayer
Brand Discription	Betaferon (interferon beta-1b) is a type of medicine known as an interferon, which is used to treat MS. Interferons are proteins found naturally in the body, which may help boost the immune system and fight infections. Betaferon belongs to a class of medi
Prescribed for	Betaferon is indicated for the treatment of patients with a single demyelinating event with an active inflammatory process, if it is severe enough to warrant treatment with intravenous corticosteroids, if alternative diagnoses have been excluded, and if t
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Powder and solvent that are made upto make solution.
Route of Administration	Subcutaneous Injection
Recommended Dosage	N.A.
Contraindication	People with severe depression or thoughts of suicide. People with severe liver disease. Pregnancy. Breastfeeding.
Side Effects	Flu-like symptoms such as fever,chills, painful joints, malaise, sweating, headache or muscular pain. These symptoms may be reduced by taking paracetamol or steroidal anti-inflammatory medicines such as ibuprofen.
Useful Link	http://www.drugs.com/uk/betaferon.html
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1345
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	In injection site reactions, symptoms can include redness, swelling, discolouration, inflammation and pain. These may be reduced by the use of an auto-injector device.
Useful Link	http://www.netdoctor.co.uk/brain-and-nervous-system/medicines/betaferon.html
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1346
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.mssociety.ie/uploads/File/Living%20with%20MS/Treating%20and%20Managing%20MS/MS%20Ireland%20Betaferon_Feb2014.pdf
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1347
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Betaseron
Company	Merck
Brand Discription	Betaseron (interferon beta-lb) is a purified, sterile, lyophilized protein product produced by recombinant DNA techniques. Interferon beta-1b is manufactured by bacterial fermentation of a strain of Escherichia coli that bears a genetically engineered pla
Prescribed for	Betaseron is used to treat relapsing multiple sclerosis (MS). Betaseron will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name	N.A.
Formulation	Lyophilized Betaseron is a sterile, white to off-white powder, for subcutaneous injection after reconstitution with the diluent supplied (Sodium Chloride, 0.54% Solution). Albumin (Human) USP and Mannitol, USP (15 mg each/vial) are added as stabilizers.
Physcial Appearance	Sterile, white to off-white powder
Route of Administration	Subcutaneous Injection
Recommended Dosage	The recommended starting dose is 0.0625 mg (0.25 mL) subcutaneously every other day, with dose increases over a six week period to the recommended dose of 0.25 mg (1 mL) every other day
Contraindication	Betaseron is contraindicated in patients with a history of hypersensitivity to natural or recombinant interferon beta, Albumin (Human).
Side Effects	Depressed mood, anxiety, trouble sleeping, restlessness, or thoughts of suicide or hurting yourself; bruising, swelling, oozing, or skin changes where the injection was given; weight changes, pounding heartbeats, feeling too hot or cold; fever, chills, bo
Useful Link	https://www.betaseron.com/home
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1348
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Weakness; headache; muscle pain or weakness; sleep problems (insomnia); stomach pain; swelling in your hands or feet; skin rash; or irregular menstrual periods.
Useful Link	http://www.rxlist.com/betaseron-drug.htm
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1349
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/betaseron.html
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1350
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Blastoferon
Company	Sidus
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1351
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Extavia
Company	Novartis
Brand Discription	EXTAVIA is a purified, sterile, lyophilized protein product produced by recombinant DNA techniques. Interferon beta-1b is manufactured by bacterial fermentation of a strain of Escherichia coli that bears a genetically engineered plasmid containing the gen
Prescribed for	Extavia is used to treat relapsing multiple sclerosis (MS). This medication will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name	N.A.
Formulation	Each vial contains 0.3 mg of interferon beta-1b. The unit measurement is derived by comparing the antiviral activity of the product to the World Health Organization (WHO) reference standard of recombinant human interferon beta. Mannitol, USP and Albumin (
Physcial Appearance	Sterile, white to off-white powder
Route of Administration	Subcutaneous Injection
Recommended Dosage	The recommended starting dose is 0.0625 mg (0.25 mL) subcutaneously every other day, with dose increases over a six week period to the recommended dose of 0.25 mg (1 mL) every other day.
Contraindication	Extavia is contraindicated in patients with a history of hypersensitivity to natural or recombinant interferon beta, Albumin (Human).
Side Effects	Depressed mood, anxiety, trouble sleeping, restlessness, or thoughts of suicide or hurting yourself; bruising, swelling, oozing, or skin changes where the injection was given; weight changes, pounding heartbeats, feeling too hot or cold; fever, chills, weating, muscle aches and tiredness.
Useful Link	http://www.extavia.com/index.jsp?usertrack.filter_applied=true&NovaId=2935376997531791734
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1352
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Weakness; headache; muscle pain or weakness; sleep problems (insomnia); stomach pain; swelling in your hands or feet; skin rash; or irregular menstrual periods.
Useful Link	http://www.rxlist.com/extavia-drug.htm
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1353
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.nationalmssociety.org/Treating-MS/Medications/Extavia
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1354
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/extavia.html
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1355
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Rebif
Company	Merck
Brand Discription	REBIF (interferon beta-1a) is a purified 166 amino acid glycoprotein with a molecular weight of approximately 22,500 daltons. It is produced by recombinant DNA technology using genetically engineered Chinese Hamster Ovary cells into which the human interf
Prescribed for	Rebif is used to treat relapsing multiple sclerosis (MS). This medication will not cure MS, it will only decrease the frequency of relapse symptoms.
Chemical Name	N.A.
Formulation	Each 0.5 mL (0.5 cc) of REBIF contains either 22 mcg or 44 mcg of interferon beta-1a, 2 mg or 4 mg albumin (human), 27.3 mg mannitol, 0.4 mg sodium acetate, and water for injection. Each 0.2 mL (0.2 cc) of REBIF contains 8.8 mcg of interferon beta-1a, 0.8
Physcial Appearance	Sterile solution in a prefilled syringe or REBIF Rebidose autoinjector
Route of Administration	Subcutaneous Injection
Recommended Dosage	The recommended dose of REBIF is either 22 mcg or 44 mcg injected subcutaneously three times per week. REBIF should be administered, if possible, at the same time (preferably in the late afternoon or evening) on the same three days (e.g., Monday, Wednesday, and Friday) at least 48 hours apart each week.
Contraindication	REBIF is contraindicated in patients with a history of hypersensitivity to natural or recombinant interferon beta, human albumin
Side Effects	Depressed mood, anxiety, trouble sleeping, restlessness, or thoughts of suicide or hurting yourself; bruising, swelling, oozing, or skin changes where the injection was given; weight changes, pounding heartbeats, feeling too hot or cold; fever, chills.
Useful Link	http://www.rebif.com/index
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1356
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Weakness; headache; muscle pain or weakness; sleep problems (insomnia); stomach pain; swelling in your hands or feet; skin rash; or irregular menstrual periods.
Useful Link	http://www.rxlist.com/rebif-drug.htm
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)

Primary information
ID	1357
ThPP ID	Th1049
Therapeutic Peptide/Protein Name	Interferon beta-1a
Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	20027
Chemical Formula	C908H1408N246O252S7
Isoelectric Point	8.93
Hydrophobicity	-0.427
Melting Point (℃)	N.A.
Half Life	10 hours
Description	Human interferon beta (166 residues, glycosylated, MW=22.5kD) is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Indication/Disease	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics	Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of Action	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	33-55 L/hour [Healthy SC injection of 60 mcg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/rebif.html
PubMed ID	27835061, 27314959, 27126827, 27035896, 26384035, 26039748, 25941954, 25846320, 25666445
3-D Structure	Th1049 (View) or (Download)