Detailed description page of THPdb

This page displays user query in tabular form.

Th1047 details

Primary information
ID 1331
ThPP ID Th1047
Therapeutic Peptide/Protein Name Alpha-1-proteinase inhibitor
Sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification IIa
Molecular Weight 44324.5
Chemical Formula C2001H3130N514O601S10
Isoelectric Point 5.37
Hydrophobicity -0.302
Melting Point (℃) 59
Half Life N.A.
Description Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease For treatment of panacinar emphysema.
Pharmacodynamics Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 5632 Â± 2006 mL [ARALAST NP]
Clearance 940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories Serine Proteinase Inhibitors
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target Neutrophil elastase
Information of corresponding available drug in the market
Brand Name Aralast
Company Baxter
Brand Discription ARALAST is an Alpha-1 proteinase inhibitor. ARALAST contains approximately 67% Alpha-PI with the C-T-terminal lysine truncation.
Prescribed for Its used to treat lung problems (emphysema) caused by a certain inherited disease (alpha-1-proteinase inhibitor deficiency). In people with this condition, lung damage is caused by elastase, a natural substance that the body needs to kill bacteria in the
Chemical Name N.A.
Formulation ARALAST NP is available as a lyophilized powder in single dose vials containing 0.5 gram or 1 gram of functional Alpha 1 -Protenase inhibitor
Physcial Appearance Lyophilized powder
Route of Administration Intravenous infusion
Recommended Dosage Recommended dose is 60 mg/kg of body weight, administered once in a week.
Contraindication ARALAST NP is contraindicated in immunoglobulin A deficient patients with antibodies against IgA, due to the risk of severe hypersensitivity.
Side Effects Fever, chills, body aches, flu symptoms, sores in your mouth and throat; pain or burning when you urinate; wheezing, chest pain or tightness, trouble breathing; or vision changes.
Useful Link http://www.baxter.com/downloads/healthcare_professionals/products/Aralast_NP_PI.pdf
PubMed ID 16773239
3-D Structure Th1047 (View) or (Download)

Primary information
ID 1332
ThPP ID Th1047
Therapeutic Peptide/Protein Name Alpha-1-proteinase inhibitor
Sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification IIa
Molecular Weight 44324.5
Chemical Formula C2001H3130N514O601S10
Isoelectric Point 5.37
Hydrophobicity -0.302
Melting Point (℃) 59
Half Life N.A.
Description Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease For treatment of panacinar emphysema.
Pharmacodynamics Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 5618 Â± 1618 mL [Aralast]
Clearance 940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories Trypsin Inhibitors
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Nausea, bloating; headache, dizziness, drowsiness; feeling tired; back pain, joint or muscle pain; swelling in your hands or feet; flushing (warmth, redness, or tingly feeling); cold symptoms such as stuffy nose, sneezing, sore throat, cough; or mild itch
Useful Link http://www.drugs.com/mtm/aralast.html
PubMed ID 16773239
3-D Structure Th1047 (View) or (Download)

Primary information
ID 1333
ThPP ID Th1047
Therapeutic Peptide/Protein Name Alpha-1-proteinase inhibitor
Sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification IIa
Molecular Weight 44324.5
Chemical Formula C2001H3130N514O601S10
Isoelectric Point 5.37
Hydrophobicity -0.302
Melting Point (℃) 59
Half Life N.A.
Description Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease For treatment of panacinar emphysema.
Pharmacodynamics Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories Enzyme Replacement Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.webmd.com/drugs/2/drug-74919/aralast-iv/details
PubMed ID 16773239
3-D Structure Th1047 (View) or (Download)

Primary information
ID 1334
ThPP ID Th1047
Therapeutic Peptide/Protein Name Alpha-1-proteinase inhibitor
Sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification IIa
Molecular Weight 44324.5
Chemical Formula C2001H3130N514O601S10
Isoelectric Point 5.37
Hydrophobicity -0.302
Melting Point (℃) 59
Half Life N.A.
Description Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease For treatment of panacinar emphysema.
Pharmacodynamics Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Prolastin
Company Talecris Biotherapeutics C formerly Bayer
Brand Discription Prolastin (alpha) is a sterile, stable, lyophilized preparation of purified human Alpha1-Proteinase Inhibitor (alpha1-PI), also known as alpha1-antitrypsin. Prolastin (alpha) is prepared from pooled human plasma of normal donors by modification and refine
Prescribed for It is used to treat alpha 1-antitrypsin deficiency in people who have symptoms of emphysema.
Chemical Name N.A.
Formulation The specific activity of Prolastin is _ 0.35 mg functional alpha1-PI/mg protein and when reconstituted as directed, the concentration of alpha1-PI is _ 20 mg/mL. When reconstituted, Prolastin (alpha) has a pH of 6.6_7.4, a sodium content of 100_210 mEq/L,
Physcial Appearance Lyophilized powder
Route of Administration Intravenous infusion
Recommended Dosage Prolastin (alpha) may be given at a rate of 0.08 mL/kg/min or greater and must be administered intravenously. The recommended dosage of 60 mg/kg takes approximately 30 minutes to infuse.
Contraindication Individuals with selective IgA deficiencies who have known antibody against IgA (anti-IgA antibody) should not receive Alpha1-Proteinase Inhibitor (Human), Prolastin (alpha) , since these patients may experience severe reactions, including anaphylaxis, to IgA which may be present.
Side Effects Fever, chills, body aches, flu symptoms, sores in your mouth and throat; pain or burning when you urinate; wheezing, chest pain or tightness, trouble breathing; or vision changes.
Useful Link http://www.prolastin.com/
PubMed ID 16773239
3-D Structure Th1047 (View) or (Download)

Primary information
ID 1335
ThPP ID Th1047
Therapeutic Peptide/Protein Name Alpha-1-proteinase inhibitor
Sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification IIa
Molecular Weight 44324.5
Chemical Formula C2001H3130N514O601S10
Isoelectric Point 5.37
Hydrophobicity -0.302
Melting Point (℃) 59
Half Life N.A.
Description Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease For treatment of panacinar emphysema.
Pharmacodynamics Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Nausea, bloating; headache, dizziness, drowsiness; feeling tired; back pain, joint or muscle pain; swelling in your hands or feet; flushing (warmth, redness, or tingly feeling); cold symptoms such as stuffy nose, sneezing, sore throat, cough; or mild itching.
Useful Link http://www.drugs.com/mtm/prolastin.html
PubMed ID 16773239
3-D Structure Th1047 (View) or (Download)

Primary information
ID 1336
ThPP ID Th1047
Therapeutic Peptide/Protein Name Alpha-1-proteinase inhibitor
Sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification IIa
Molecular Weight 44324.5
Chemical Formula C2001H3130N514O601S10
Isoelectric Point 5.37
Hydrophobicity -0.302
Melting Point (℃) 59
Half Life N.A.
Description Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease For treatment of panacinar emphysema.
Pharmacodynamics Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/prolastin-drug.htm
PubMed ID 16773239
3-D Structure Th1047 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1331
ThPP ID	Th1047
Therapeutic Peptide/Protein Name	Alpha-1-proteinase inhibitor
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	44324.5
Chemical Formula	C2001H3130N514O601S10
Isoelectric Point	5.37
Hydrophobicity	-0.302
Melting Point (℃)	59
Half Life	N.A.
Description	Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease	For treatment of panacinar emphysema.
Pharmacodynamics	Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action	Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	5632 Â± 2006 mL [ARALAST NP]
Clearance	940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories	Serine Proteinase Inhibitors
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	Neutrophil elastase
Information of corresponding available drug in the market
Brand Name	Aralast
Company	Baxter
Brand Discription	ARALAST is an Alpha-1 proteinase inhibitor. ARALAST contains approximately 67% Alpha-PI with the C-T-terminal lysine truncation.
Prescribed for	Its used to treat lung problems (emphysema) caused by a certain inherited disease (alpha-1-proteinase inhibitor deficiency). In people with this condition, lung damage is caused by elastase, a natural substance that the body needs to kill bacteria in the
Chemical Name	N.A.
Formulation	ARALAST NP is available as a lyophilized powder in single dose vials containing 0.5 gram or 1 gram of functional Alpha 1 -Protenase inhibitor
Physcial Appearance	Lyophilized powder
Route of Administration	Intravenous infusion
Recommended Dosage	Recommended dose is 60 mg/kg of body weight, administered once in a week.
Contraindication	ARALAST NP is contraindicated in immunoglobulin A deficient patients with antibodies against IgA, due to the risk of severe hypersensitivity.
Side Effects	Fever, chills, body aches, flu symptoms, sores in your mouth and throat; pain or burning when you urinate; wheezing, chest pain or tightness, trouble breathing; or vision changes.
Useful Link	http://www.baxter.com/downloads/healthcare_professionals/products/Aralast_NP_PI.pdf
PubMed ID	16773239
3-D Structure	Th1047 (View) or (Download)

Primary information
ID	1332
ThPP ID	Th1047
Therapeutic Peptide/Protein Name	Alpha-1-proteinase inhibitor
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	44324.5
Chemical Formula	C2001H3130N514O601S10
Isoelectric Point	5.37
Hydrophobicity	-0.302
Melting Point (℃)	59
Half Life	N.A.
Description	Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease	For treatment of panacinar emphysema.
Pharmacodynamics	Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action	Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	5618 Â± 1618 mL [Aralast]
Clearance	940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories	Trypsin Inhibitors
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Nausea, bloating; headache, dizziness, drowsiness; feeling tired; back pain, joint or muscle pain; swelling in your hands or feet; flushing (warmth, redness, or tingly feeling); cold symptoms such as stuffy nose, sneezing, sore throat, cough; or mild itch
Useful Link	http://www.drugs.com/mtm/aralast.html
PubMed ID	16773239
3-D Structure	Th1047 (View) or (Download)

Primary information
ID	1333
ThPP ID	Th1047
Therapeutic Peptide/Protein Name	Alpha-1-proteinase inhibitor
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	44324.5
Chemical Formula	C2001H3130N514O601S10
Isoelectric Point	5.37
Hydrophobicity	-0.302
Melting Point (℃)	59
Half Life	N.A.
Description	Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease	For treatment of panacinar emphysema.
Pharmacodynamics	Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action	Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories	Enzyme Replacement Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.webmd.com/drugs/2/drug-74919/aralast-iv/details
PubMed ID	16773239
3-D Structure	Th1047 (View) or (Download)

Primary information
ID	1334
ThPP ID	Th1047
Therapeutic Peptide/Protein Name	Alpha-1-proteinase inhibitor
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	44324.5
Chemical Formula	C2001H3130N514O601S10
Isoelectric Point	5.37
Hydrophobicity	-0.302
Melting Point (℃)	59
Half Life	N.A.
Description	Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease	For treatment of panacinar emphysema.
Pharmacodynamics	Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action	Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Prolastin
Company	Talecris Biotherapeutics C formerly Bayer
Brand Discription	Prolastin (alpha) is a sterile, stable, lyophilized preparation of purified human Alpha1-Proteinase Inhibitor (alpha1-PI), also known as alpha1-antitrypsin. Prolastin (alpha) is prepared from pooled human plasma of normal donors by modification and refine
Prescribed for	It is used to treat alpha 1-antitrypsin deficiency in people who have symptoms of emphysema.
Chemical Name	N.A.
Formulation	The specific activity of Prolastin is _ 0.35 mg functional alpha1-PI/mg protein and when reconstituted as directed, the concentration of alpha1-PI is _ 20 mg/mL. When reconstituted, Prolastin (alpha) has a pH of 6.6_7.4, a sodium content of 100_210 mEq/L,
Physcial Appearance	Lyophilized powder
Route of Administration	Intravenous infusion
Recommended Dosage	Prolastin (alpha) may be given at a rate of 0.08 mL/kg/min or greater and must be administered intravenously. The recommended dosage of 60 mg/kg takes approximately 30 minutes to infuse.
Contraindication	Individuals with selective IgA deficiencies who have known antibody against IgA (anti-IgA antibody) should not receive Alpha1-Proteinase Inhibitor (Human), Prolastin (alpha) , since these patients may experience severe reactions, including anaphylaxis, to IgA which may be present.
Side Effects	Fever, chills, body aches, flu symptoms, sores in your mouth and throat; pain or burning when you urinate; wheezing, chest pain or tightness, trouble breathing; or vision changes.
Useful Link	http://www.prolastin.com/
PubMed ID	16773239
3-D Structure	Th1047 (View) or (Download)

Primary information
ID	1335
ThPP ID	Th1047
Therapeutic Peptide/Protein Name	Alpha-1-proteinase inhibitor
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	44324.5
Chemical Formula	C2001H3130N514O601S10
Isoelectric Point	5.37
Hydrophobicity	-0.302
Melting Point (℃)	59
Half Life	N.A.
Description	Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease	For treatment of panacinar emphysema.
Pharmacodynamics	Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action	Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Nausea, bloating; headache, dizziness, drowsiness; feeling tired; back pain, joint or muscle pain; swelling in your hands or feet; flushing (warmth, redness, or tingly feeling); cold symptoms such as stuffy nose, sneezing, sore throat, cough; or mild itching.
Useful Link	http://www.drugs.com/mtm/prolastin.html
PubMed ID	16773239
3-D Structure	Th1047 (View) or (Download)

Primary information
ID	1336
ThPP ID	Th1047
Therapeutic Peptide/Protein Name	Alpha-1-proteinase inhibitor
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	44324.5
Chemical Formula	C2001H3130N514O601S10
Isoelectric Point	5.37
Hydrophobicity	-0.302
Melting Point (℃)	59
Half Life	N.A.
Description	Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
Indication/Disease	For treatment of panacinar emphysema.
Pharmacodynamics	Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema.
Mechanism of Action	Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	940 Â± 275 mL/day [Patients with congenital deficiency with single IV infusion of 60mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/prolastin-drug.htm
PubMed ID	16773239
3-D Structure	Th1047 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb