| Primary information |
|---|
| ID | 1316 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 12 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | Antirheumatic Agents |
| Patents Number | CA2243459 |
| Date of Issue | 17/09/02 |
| Date of Expiry | 10/02/17 |
| Drug Interaction | Canakinumab and Rilonacept increase immunosuppressive effects and risk of infection. |
| Target | Tumor necrosis factor,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamm |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Humira |
| Company | Abbott Laboratories |
| Brand Discription | HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant |
| Prescribed for | Humira is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without succe |
| Chemical Name | N.A. |
| Formulation | It is supplied for a single use. Each prefilled syringe delivers 0.8 mL (40 mg) of drug product. Each 0.8 mL of HUMIRA contains 40 mg adalimumab, 4.93 mg sodium chloride, 0.69 mg monobasic sodium phosphate dihydrate, 1.22 mg dibasic sodium phosphate dihyd |
| Physcial Appearance | Sterile, preservative-free solution |
| Route of Administration | Subcutaneous administration |
| Recommended Dosage | The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA. |
| Contraindication | Hypersensitivity |
| Side Effects | Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness. |
| Useful Link | PDB sequence Link:http://www.rcsb.org/pdb/download/downloadFile.do?fileFormat=FASTA;compression=NO;structureId=1IGT |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1317 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 13 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | Anti-Inflammatory Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | Patent Information Link:http://www.freepatentsonline.com/6090382.html |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1318 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 14 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | Immunosuppressive Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Adalimumab (and other anti-TNF immunosuppressants), when used in combination with tofacitinib, may increase the risk of added immunosuppression. It is recommended to avoid concurrent therapy. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Humira Pen |
| Company | Abbott Laboratories |
| Brand Discription | HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant |
| Prescribed for | It is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without successfu |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Sterile, preservative-free solution |
| Route of Administration | Subcutaneous Injection |
| Recommended Dosage | The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids,nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA. |
| Contraindication | Hypersensitivity |
| Side Effects | Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness. |
| Useful Link | https://www.humira.com/ |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1319 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 15 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.webmd.com/drugs/2/drug-144769/humira-pen-subcutaneous/details |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1320 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 16 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/mtm/humira-pen.html |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1321 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 17 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/humira.html |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1322 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 18 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/humira-drug.htm |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |
| Primary information |
|---|
| ID | 1323 |
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 19 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | https://www.humira.com/ |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |