Updated version of this database is available at ThpDB2

Detailed description page of THPdb

This page displays user query in tabular form.

Th1044 details
Primary information
ID1316
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance12 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesAntirheumatic Agents
Patents NumberCA2243459
Date of Issue17/09/02
Date of Expiry10/02/17
Drug InteractionCanakinumab and Rilonacept increase immunosuppressive effects and risk of infection.
TargetTumor necrosis factor,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamm
Information of corresponding available drug in the market
Brand NameHumira
CompanyAbbott Laboratories
Brand DiscriptionHUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed forHumira is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without succe
Chemical NameN.A.
FormulationIt is supplied for a single use. Each prefilled syringe delivers 0.8 mL (40 mg) of drug product. Each 0.8 mL of HUMIRA contains 40 mg adalimumab, 4.93 mg sodium chloride, 0.69 mg monobasic sodium phosphate dihydrate, 1.22 mg dibasic sodium phosphate dihyd
Physcial AppearanceSterile, preservative-free solution
Route of AdministrationSubcutaneous administration
Recommended DosageThe recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
ContraindicationHypersensitivity
Side EffectsFever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful LinkPDB sequence Link:http://www.rcsb.org/pdb/download/downloadFile.do?fileFormat=FASTA;compression=NO;structureId=1IGT
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1317
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance13 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesAnti-Inflammatory Agents
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionTrastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsN.A.
Useful LinkPatent Information Link:http://www.freepatentsonline.com/6090382.html
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1318
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance14 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesImmunosuppressive Agents
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionAdalimumab (and other anti-TNF immunosuppressants), when used in combination with tofacitinib, may increase the risk of added immunosuppression. It is recommended to avoid concurrent therapy.
TargetN.A.
Information of corresponding available drug in the market
Brand NameHumira Pen
CompanyAbbott Laboratories
Brand DiscriptionHUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed forIt is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without successfu
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceSterile, preservative-free solution
Route of AdministrationSubcutaneous Injection
Recommended DosageThe recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids,nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
ContraindicationHypersensitivity
Side EffectsFever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful Linkhttps://www.humira.com/
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1319
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance15 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesN.A.
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsN.A.
Useful Linkhttp://www.webmd.com/drugs/2/drug-144769/humira-pen-subcutaneous/details
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1320
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance16 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesN.A.
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsN.A.
Useful Linkhttp://www.drugs.com/mtm/humira-pen.html
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1321
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance17 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesN.A.
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsN.A.
Useful Linkhttp://www.drugs.com/humira.html
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1322
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance18 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesN.A.
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsN.A.
Useful Linkhttp://www.rxlist.com/humira-drug.htm
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)
Primary information
ID1323
ThPP IDTh1044
Therapeutic Peptide/Protein NameAdalimumab
SequenceLight-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional ClassificationIc
Molecular Weight144190.3
Chemical FormulaC6428H9912N1694O1987S46
Isoelectric Point8.25
Hydrophobicity-0.441
Melting Point (℃)N.A.
Half Life240-480 hours
DescriptionAdalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/DiseaseFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of ActionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
ToxicityN.A.
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
AbsorptionN.A.
Volume of DistributionN.A.
Clearance19 mL/hr [RA patients with dose 0.25-10 mg/kg]
CategoriesN.A.
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsN.A.
Useful Linkhttps://www.humira.com/
PubMed ID25629655, 23620660
3-D StructureTh1044 (View) or (Download)