Detailed description page of THPdb

This page displays user query in tabular form.

Th1043 details

Primary information
ID 1305
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 110 to 127 mL/kg [pediatric patients]
Clearance N.A.
Categories Gout Suppressants
Patents Number CA2175971
Date of Issue 30/12/03
Date of Expiry 07/05/16
Drug Interaction amyl nitrite / sodium nitrite / sodium thiosulfate
Target Uric acid
Information of corresponding available drug in the market
Brand Name Elitek
Company Sanofi-Synthelabo Inc
Brand Discription Elitek is a recombinant urate-oxidase produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. Rasburicase is a tetrameric protein with identical subunits. Each sub
Prescribed for Used for preventing high blood levels of uric acid from occurring in patients with certain types of cancer (eg, leukemia, lymphoma, solid malignant tumors) who are receiving cancer chemotherapy treatment.
Chemical Name N.A.
Formulation Elitek is supplied in 3 mL and 10 mL colorless, glass vials containing rasburicase at a concentration of 1.5 mg/mL after reconstitution. Elitek 1.5 mg presentation contains 1.5 mg rasburicase, 10.6 mg mannitol, 15.9 mg L-alanine, between 12.6 and 14.3 mg
Physcial Appearance Sterile, white to off-white, lyophilized powder
Route of Administration Intravenous administration
Recommended Dosage The recommended dose of Elitek is 0.2 mg/kg as a 30 minute Intravenous infusion daily for up to 5 days. Dosing beyond 5 days or administration of more than one course is not recommended.
Contraindication Pateints with history of anaphylaxic or severe hypersensitivity
Side Effects Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin.
Useful Link http://www.elitek.us
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1306
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 75.8 to 138 mL/kg [adult patients]
Clearance N.A.
Categories Antihyperuricemic Agents
Patents Number CA2148537
Date of Issue 16/07/02
Date of Expiry 03/05/15
Drug Interaction Citanest Forte (epinephrine / prilocaine)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Individulas deficient in glucose -6-phosphate dehydrogenase.
Side Effects N.A.
Useful Link http://www.drugs.com/cdi/elitek.html
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1307
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Citanest HCl Plain (prilocaine)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/elitek-drug.htm
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1308
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Cyanide Antidote Kit (amyl nitrite / sodium nitrite / sodium thiosulfate)
Target N.A.
Information of corresponding available drug in the market
Brand Name Fasturtec
Company N.A.
Brand Discription Fasturtec is a medicine that contains the active substance rasburicase. It is a recombinant urate-oxidase enzyme produced by genetically modified Saccharomyces cerevisiae strain. Rasburicase is a tetrameric protein with identical subunits of a molecular
Prescribed for Fasturtec is used to treat and prevent high levels of uric acid in the blood in order to prevent kidney failure. It is used in adults and children with blood cancers who are at risk of a sudden rise in uric acid levels when they start to receive chemother
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Powder and solvent that are made upto make solution.
Route of Administration Intravenous administartion
Recommended Dosage The recommended dose is 0.2 mg per kilogram body weight in both children and adults, given as a daily infusion for up to seven days. The duration of treatment is adjusted depending on the patientâ€™s blood levels of uric acid and the doctorâ€™s judgment.
Contraindication Hypersensitivity
Side Effects Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin.
Useful Link http://www.ncbi.nlm.nih.gov/pubmed/15493120
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1309
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Emla (lidocaine / prilocaine topical)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Pateint with a deficiency in glucose-6-phoshphate dehydrogenase or other metabolic disorder known to cause haemolytic anaemia.
Side Effects N.A.
Useful Link http://www.drugs.com/uk/fasturtec.html
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1310
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Emla Anesthetic Disc (lidocaine / prilocaine topical)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.medicines.org.uk/emc/medicine/4604
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1311
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction epinephrine / prilocaine
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1312
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction lidocaine / prilocaine topical
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1313
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Nithiodote (sodium nitrite / sodium thiosulfate)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1314
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Oraqix (lidocaine / prilocaine topical)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

Primary information
ID 1315
ThPP ID Th1043
Therapeutic Peptide/Protein Name Rasburicase
Sequence SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 34109.5
Chemical Formula C1521H2381N417O461S7
Isoelectric Point 7.16
Hydrophobicity -0.465
Melting Point (℃) N.A.
Half Life 18 hours
Description Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction sodium nitrite / sodium thiosulfate
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20445229, 20394650
3-D Structure Th1043 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1305
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	110 to 127 mL/kg [pediatric patients]
Clearance	N.A.
Categories	Gout Suppressants
Patents Number	CA2175971
Date of Issue	30/12/03
Date of Expiry	07/05/16
Drug Interaction	amyl nitrite / sodium nitrite / sodium thiosulfate
Target	Uric acid
Information of corresponding available drug in the market
Brand Name	Elitek
Company	Sanofi-Synthelabo Inc
Brand Discription	Elitek is a recombinant urate-oxidase produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. Rasburicase is a tetrameric protein with identical subunits. Each sub
Prescribed for	Used for preventing high blood levels of uric acid from occurring in patients with certain types of cancer (eg, leukemia, lymphoma, solid malignant tumors) who are receiving cancer chemotherapy treatment.
Chemical Name	N.A.
Formulation	Elitek is supplied in 3 mL and 10 mL colorless, glass vials containing rasburicase at a concentration of 1.5 mg/mL after reconstitution. Elitek 1.5 mg presentation contains 1.5 mg rasburicase, 10.6 mg mannitol, 15.9 mg L-alanine, between 12.6 and 14.3 mg
Physcial Appearance	Sterile, white to off-white, lyophilized powder
Route of Administration	Intravenous administration
Recommended Dosage	The recommended dose of Elitek is 0.2 mg/kg as a 30 minute Intravenous infusion daily for up to 5 days. Dosing beyond 5 days or administration of more than one course is not recommended.
Contraindication	Pateints with history of anaphylaxic or severe hypersensitivity
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin.
Useful Link	http://www.elitek.us
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1306
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	75.8 to 138 mL/kg [adult patients]
Clearance	N.A.
Categories	Antihyperuricemic Agents
Patents Number	CA2148537
Date of Issue	16/07/02
Date of Expiry	03/05/15
Drug Interaction	Citanest Forte (epinephrine / prilocaine)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Individulas deficient in glucose -6-phosphate dehydrogenase.
Side Effects	N.A.
Useful Link	http://www.drugs.com/cdi/elitek.html
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1307
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Citanest HCl Plain (prilocaine)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/elitek-drug.htm
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1308
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Cyanide Antidote Kit (amyl nitrite / sodium nitrite / sodium thiosulfate)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Fasturtec
Company	N.A.
Brand Discription	Fasturtec is a medicine that contains the active substance rasburicase. It is a recombinant urate-oxidase enzyme produced by genetically modified Saccharomyces cerevisiae strain. Rasburicase is a tetrameric protein with identical subunits of a molecular
Prescribed for	Fasturtec is used to treat and prevent high levels of uric acid in the blood in order to prevent kidney failure. It is used in adults and children with blood cancers who are at risk of a sudden rise in uric acid levels when they start to receive chemother
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Powder and solvent that are made upto make solution.
Route of Administration	Intravenous administartion
Recommended Dosage	The recommended dose is 0.2 mg per kilogram body weight in both children and adults, given as a daily infusion for up to seven days. The duration of treatment is adjusted depending on the patientâ€™s blood levels of uric acid and the doctorâ€™s judgment.
Contraindication	Hypersensitivity
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin.
Useful Link	http://www.ncbi.nlm.nih.gov/pubmed/15493120
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1309
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Emla (lidocaine / prilocaine topical)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Pateint with a deficiency in glucose-6-phoshphate dehydrogenase or other metabolic disorder known to cause haemolytic anaemia.
Side Effects	N.A.
Useful Link	http://www.drugs.com/uk/fasturtec.html
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1310
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Emla Anesthetic Disc (lidocaine / prilocaine topical)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.medicines.org.uk/emc/medicine/4604
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1311
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	epinephrine / prilocaine
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1312
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	lidocaine / prilocaine topical
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1313
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Nithiodote (sodium nitrite / sodium thiosulfate)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1314
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Oraqix (lidocaine / prilocaine topical)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)

Primary information
ID	1315
ThPP ID	Th1043
Therapeutic Peptide/Protein Name	Rasburicase
Sequence	SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	34109.5
Chemical Formula	C1521H2381N417O461S7
Isoelectric Point	7.16
Hydrophobicity	-0.465
Melting Point (℃)	N.A.
Half Life	18 hours
Description	Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Indication/Disease	For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy).
Pharmacodynamics	Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of Action	Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	sodium nitrite / sodium thiosulfate
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20445229, 20394650
3-D Structure	Th1043 (View) or (Download)