Detailed description page of THPdb

This page displays user query in tabular form.

Th1031 details

Primary information
ID 1229
ThPP ID Th1031
Therapeutic Peptide/Protein Name Interferon Alfa-2a, Recombinant
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) N.A.
Half Life IM half-life of interferon alfa-2a is 6 hours to 8 hours
Description Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism N.A.
Absorption Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution 0.223 to 0.748 L/kg [healthy people]
Clearance 2.14 - 3.62 mL/min/kg [healthy]
Categories N.A.
Patents Number CA2172664
Date of Issue 03/10/00
Date of Expiry 26/03/16
Drug Interaction Interferon increases the effect and toxicity of theophylline
Target Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Information of corresponding available drug in the market
Brand Name Roferon A
Company Hoffmann-La Roche Inc
Brand Discription Roferon-A is manufactured by recombinant DNA technology that employs a genetically engineered Escherichia coli bacterium containing DNA that codes for the human protein. Interferon alfa-2a, recombinant is a highly purified protein containing 165 amino aci
Prescribed for To treat chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (with
Chemical Name N.A.
Formulation 3 million IU (11.1 mcg/0.5 mL) Roferon-A (interferon alfa-2a, recombinant) per syringe â€” The solution is colorless and each 0.5 mL contains 3 MIU of Interferon alfa-2a, recombinant, 3.605 mg sodium chloride, 0.1 mg polysorbate 80, 5 mg benzyl alcohol as a
Physcial Appearance Solution
Route of Administration Subcutaneous Injection
Recommended Dosage Dosage for the treatment of chronic hepatitis C is 3 MIU three times a week (tiw) administered subcutaneously for 12 months (48-52 weeks). As an alternative, patients may be treated with an induction dose of 6 MIU tiw for the first 3 months (12 weeks) followed by 3 MIU tiw for 9 months (36 weeks).
Contraindication Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components
Side Effects Injection site reactions (pain/swelling/redness), headache, tiredness, diarrhea, upset stomach, loss of appetite, back pain, dizziness, dry mouth, taste changes, nausea, or vomiting may occur. Tooth and gum problems may sometimes occur during treatment.
Useful Link http://www.fda.gov/downloads/Drugs/DrugSafety/ucm111340.pdf
PubMed ID 3598612
3-D Structure Th1031 (View) or (Download)

Primary information
ID 1230
ThPP ID Th1031
Therapeutic Peptide/Protein Name Interferon Alfa-2a, Recombinant
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) N.A.
Half Life Half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism N.A.
Absorption Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution 0.223 to 0.748 L/kg [healthy people]
Clearance 2.14 - 3.62 mL/min/kg [healthy]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Aminophylline interferon increases the effect and toxicity of theophylline
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Autoimmune hepatitis or hepatic decompensation (Child-Pugh class B and C) before or during treatment.
Side Effects N.A.
Useful Link http://www.rxlist.com/roferon-a-drug.htm
PubMed ID 3598612
3-D Structure Th1031 (View) or (Download)

Primary information
ID 1231
ThPP ID Th1031
Therapeutic Peptide/Protein Name Interferon Alfa-2a, Recombinant
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) N.A.
Half Life N.A.
Description Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism N.A.
Absorption Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution 0.223 to 0.748 L/kg [healthy people]
Clearance 2.14 - 3.62 mL/min/kg [healthy]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Dyphylline interferon increases the effect and toxicity of theophylline
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Side Effects N.A.
Useful Link http://www.webmd.com/drugs/2/drug-963/roferon-a-inj/details
PubMed ID 3598612
3-D Structure Th1031 (View) or (Download)

Primary information
ID 1232
ThPP ID Th1031
Therapeutic Peptide/Protein Name Interferon Alfa-2a, Recombinant
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) N.A.
Half Life N.A.
Description Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism N.A.
Absorption Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution 0.223 to 0.748 L/kg [healthy people]
Clearance 2.14 - 3.62 mL/min/kg [healthy]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Oxtriphylline, interferon increases the effect and toxicity of theophylline
Target N.A.
Information of corresponding available drug in the market
Brand Name Veldona
Company Amarillo Biosciences
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 3598612
3-D Structure Th1031 (View) or (Download)

Primary information
ID 1233
ThPP ID Th1031
Therapeutic Peptide/Protein Name Interferon Alfa-2a, Recombinant
Sequence CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 19241.1
Chemical Formula C860H1353N227O255S9
Isoelectric Point 5.99
Hydrophobicity -0.336
Melting Point (℃) N.A.
Half Life N.A.
Description Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism N.A.
Absorption Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution 0.223 to 0.748 L/kg [healthy people]
Clearance 2.14 - 3.62 mL/min/kg [healthy]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Roferon-A (interferon alfa-2a, recombinant) has been reported to reduce the clearance of theophylline. Synergistic toxicity has been observed when Roferon-A (interferon alfa-2a, recombinant) is administered in combination with zidovudine (AZT)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 3598612
3-D Structure Th1031 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1229
ThPP ID	Th1031
Therapeutic Peptide/Protein Name	Interferon Alfa-2a, Recombinant
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	N.A.
Half Life	IM half-life of interferon alfa-2a is 6 hours to 8 hours
Description	Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action	It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism	N.A.
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution	0.223 to 0.748 L/kg [healthy people]
Clearance	2.14 - 3.62 mL/min/kg [healthy]
Categories	N.A.
Patents Number	CA2172664
Date of Issue	03/10/00
Date of Expiry	26/03/16
Drug Interaction	Interferon increases the effect and toxicity of theophylline
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Information of corresponding available drug in the market
Brand Name	Roferon A
Company	Hoffmann-La Roche Inc
Brand Discription	Roferon-A is manufactured by recombinant DNA technology that employs a genetically engineered Escherichia coli bacterium containing DNA that codes for the human protein. Interferon alfa-2a, recombinant is a highly purified protein containing 165 amino aci
Prescribed for	To treat chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (with
Chemical Name	N.A.
Formulation	3 million IU (11.1 mcg/0.5 mL) Roferon-A (interferon alfa-2a, recombinant) per syringe â€” The solution is colorless and each 0.5 mL contains 3 MIU of Interferon alfa-2a, recombinant, 3.605 mg sodium chloride, 0.1 mg polysorbate 80, 5 mg benzyl alcohol as a
Physcial Appearance	Solution
Route of Administration	Subcutaneous Injection
Recommended Dosage	Dosage for the treatment of chronic hepatitis C is 3 MIU three times a week (tiw) administered subcutaneously for 12 months (48-52 weeks). As an alternative, patients may be treated with an induction dose of 6 MIU tiw for the first 3 months (12 weeks) followed by 3 MIU tiw for 9 months (36 weeks).
Contraindication	Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components
Side Effects	Injection site reactions (pain/swelling/redness), headache, tiredness, diarrhea, upset stomach, loss of appetite, back pain, dizziness, dry mouth, taste changes, nausea, or vomiting may occur. Tooth and gum problems may sometimes occur during treatment.
Useful Link	http://www.fda.gov/downloads/Drugs/DrugSafety/ucm111340.pdf
PubMed ID	3598612
3-D Structure	Th1031 (View) or (Download)

Primary information
ID	1230
ThPP ID	Th1031
Therapeutic Peptide/Protein Name	Interferon Alfa-2a, Recombinant
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	N.A.
Half Life	Half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action	It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism	N.A.
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution	0.223 to 0.748 L/kg [healthy people]
Clearance	2.14 - 3.62 mL/min/kg [healthy]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Aminophylline interferon increases the effect and toxicity of theophylline
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Autoimmune hepatitis or hepatic decompensation (Child-Pugh class B and C) before or during treatment.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/roferon-a-drug.htm
PubMed ID	3598612
3-D Structure	Th1031 (View) or (Download)

Primary information
ID	1231
ThPP ID	Th1031
Therapeutic Peptide/Protein Name	Interferon Alfa-2a, Recombinant
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action	It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism	N.A.
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution	0.223 to 0.748 L/kg [healthy people]
Clearance	2.14 - 3.62 mL/min/kg [healthy]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Dyphylline interferon increases the effect and toxicity of theophylline
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Side Effects	N.A.
Useful Link	http://www.webmd.com/drugs/2/drug-963/roferon-a-inj/details
PubMed ID	3598612
3-D Structure	Th1031 (View) or (Download)

Primary information
ID	1232
ThPP ID	Th1031
Therapeutic Peptide/Protein Name	Interferon Alfa-2a, Recombinant
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action	It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism	N.A.
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution	0.223 to 0.748 L/kg [healthy people]
Clearance	2.14 - 3.62 mL/min/kg [healthy]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Oxtriphylline, interferon increases the effect and toxicity of theophylline
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Veldona
Company	Amarillo Biosciences
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	3598612
3-D Structure	Th1031 (View) or (Download)

Primary information
ID	1233
ThPP ID	Th1031
Therapeutic Peptide/Protein Name	Interferon Alfa-2a, Recombinant
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Its a type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a bbetter target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R.
Mechanism of Action	It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic a
Metabolism	N.A.
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of Distribution	0.223 to 0.748 L/kg [healthy people]
Clearance	2.14 - 3.62 mL/min/kg [healthy]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Roferon-A (interferon alfa-2a, recombinant) has been reported to reduce the clearance of theophylline. Synergistic toxicity has been observed when Roferon-A (interferon alfa-2a, recombinant) is administered in combination with zidovudine (AZT)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	3598612
3-D Structure	Th1031 (View) or (Download)