Detailed description page of THPdb

This page displays user query in tabular form.

Th1029 details

Primary information
ID 1215
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Antagon (ganirelix)
Target Follicle-stimulating hormone receptor,Lutropin-choriogonadotropic hormone receptor
Information of corresponding available drug in the market
Brand Name Menopur
Company N.A.
Brand Discription MENOPUR is a preparation of gonadotropins (FSH and LH activity), extracted from the urine of postmenopausal women, which has undergone additional steps for purification
Prescribed for Menotropins are used to stimulate ovulation (the release of an egg) when a woman's ovaries can produce a follicle but hormonal stimulation is deficient. Menotropins are also used to stimulate the development of multiple eggs for in vitro fertilization. Li
Chemical Name N.A.
Formulation Each vial of MENOPUR contains 75 International Units of follicle-stimulating hormone (FSH) activity and 75 International Units of luteinizing hormone (LH) activity, plus 21 mg lactose monohydrate and 0.005 mg Polysorbate 20 and Sodium Phosphate Buffer (So
Physcial Appearance Sterile, lyophilized powder which is reconstitution with Sterile 0.9% Sodium Chloride Injection.
Route of Administration Subcutaneous Injection
Recommended Dosage The dosing scheme for patients undergoing IVF follows a stepwise approach and is individualized for each woman. The recommended initial dose of MENOPUR for women who have received a GnRH agonist for pituitary suppression is 225 International Units. MENOPU
Contraindication Hypersensitivity, high level of FSH indicating primary ovarian failure, cause fetal harm when administerd to prergnant woman, ex hormone dependent tumors of the reproductive tract and accessory organs.
Side Effects Less than 2% of female patients treated with menotropins develop ovarian hyperstimulation syndrome (OHSS), especially after the first cycle of therapy. Symptoms of OHSS include swelling of the hands or legs, abdominal pain and swelling, shortness of breathing.
Useful Link http://www.drugs.com/drug-interactions/menotropins,menopur-index.html
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1216
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Follicle stimulating hormone / ganirelix
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Tumors of pituitary gland or hypothalamus and abnormal uterine bleeding of undetermined origin
Side Effects Ovarian enlargement presenting as abdominal or pelvic pain, tenderness, pressure, or swelling; nausea, vomiting, or diarrhea; shortness of breath; pain, warmth, or tenderness centralized in an arm or leg; fever or chills.
Useful Link http://www.rxlist.com/menopur-drug.htm
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1217
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Follistim / Antagon (follicle stimulating hormone / ganirelix)
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Ovarian cyst or enlargement of undetermined origin, not due to polycystic ovary syndrome
Side Effects Headache or drowsiness; weakness or aching of muscles or joints; breast enlargement or tenderness; pain, swelling, or irritation at the injection site; or rash.
Useful Link http://www.drugs.com/mtm/menopur-injectable.html
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1218
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Repronex
Company N.A.
Brand Discription Repronex (menotropins for injection, USP) is a purified preparation of gonadotropins extracted from the urine of postmenopausal women. It is a combination of hormones which works by stimulating the ovaries to produce eggs
Prescribed for Repronex is generally used as part of an assisted reproductive technology (ART) program to treat infertility in women.
Chemical Name N.A.
Formulation Each vial of Repronex (menotropins for injection) contains 75 International Units (IU) or 150 IU of follicle-stimulating hormone (FSH) activity and 75 IU or 150 IU of luteinizing hormone (LH) activity, respectively, plus 20 mg lactose monohydrate in a ste
Physcial Appearance Sterile, lyophilized form
Route of Administration Subcutaneous or intramuSubcutaneousular Injection.
Recommended Dosage The initial dose of Repronex (menotropins for injection) for patients who have received GnRH agonist or antagonist pituitary suppression is 150 IU daily for the first 5 days of treatment. Based on clinical monitoring (including serum estradiol levels and
Contraindication A high FSH level indicating primary ovarian failure.
Side Effects Rash; hives; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); breast pain or enlarged breasts; calf, leg, or arm pain, swelling, redness, or tenderness; change in balance
Useful Link http://www.drugs.com/cdi/repronex.html
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1219
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication An organic intracranial lesion such as a pituitary tumor.
Side Effects Change in color of skin to a bluish color (eg, on the lips, nail beds, fingers, toes); changes in speech or vision; chest, jaw, or arm pain; confusion; coughing up blood; fainting; fast breathing; fast heartbeat.
Useful Link http://www.drugs.com/drug-interactions/menotropins,repronex-index.html
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1220
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Ovarian cysts or enlargement not due to polycystic ovary syndrome.
Side Effects Flu-like symptoms; one-sided weakness; pale skin; shortness of breath; sudden, severe nausea or vomiting; unusual sweating; weakness; yellowing of the skin or eyes.
Useful Link http://www.rxlist.com/repronex-drug.htm
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1221
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Uncontrolled thyroid and adrenal dysfunction.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1222
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication The presence of any cause of infertility other than anovulation unless they are candidates for in vitro-fertilization.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1223
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Abnormal bleeding of undetermined origin.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1224
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Prior hypersensitivity to menotropins
Side Effects N.A.
Useful Link N.A.
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

Primary information
ID 1225
ThPP ID Th1029
Therapeutic Peptide/Protein Name Menotropins
Sequence Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification Ib
Molecular Weight 23390.3
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life N.A.
Description Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Repronex (menotropins for injection) is not indicated in women who are pregnant. There are limited human data on the effects of menotropins when administered during pregnancy.
Side Effects N.A.
Useful Link N.A.
PubMed ID 18020563
3-D Structure Th1029 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1215
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Antagon (ganirelix)
Target	Follicle-stimulating hormone receptor,Lutropin-choriogonadotropic hormone receptor
Information of corresponding available drug in the market
Brand Name	Menopur
Company	N.A.
Brand Discription	MENOPUR is a preparation of gonadotropins (FSH and LH activity), extracted from the urine of postmenopausal women, which has undergone additional steps for purification
Prescribed for	Menotropins are used to stimulate ovulation (the release of an egg) when a woman's ovaries can produce a follicle but hormonal stimulation is deficient. Menotropins are also used to stimulate the development of multiple eggs for in vitro fertilization. Li
Chemical Name	N.A.
Formulation	Each vial of MENOPUR contains 75 International Units of follicle-stimulating hormone (FSH) activity and 75 International Units of luteinizing hormone (LH) activity, plus 21 mg lactose monohydrate and 0.005 mg Polysorbate 20 and Sodium Phosphate Buffer (So
Physcial Appearance	Sterile, lyophilized powder which is reconstitution with Sterile 0.9% Sodium Chloride Injection.
Route of Administration	Subcutaneous Injection
Recommended Dosage	The dosing scheme for patients undergoing IVF follows a stepwise approach and is individualized for each woman. The recommended initial dose of MENOPUR for women who have received a GnRH agonist for pituitary suppression is 225 International Units. MENOPU
Contraindication	Hypersensitivity, high level of FSH indicating primary ovarian failure, cause fetal harm when administerd to prergnant woman, ex hormone dependent tumors of the reproductive tract and accessory organs.
Side Effects	Less than 2% of female patients treated with menotropins develop ovarian hyperstimulation syndrome (OHSS), especially after the first cycle of therapy. Symptoms of OHSS include swelling of the hands or legs, abdominal pain and swelling, shortness of breathing.
Useful Link	http://www.drugs.com/drug-interactions/menotropins,menopur-index.html
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1216
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Follicle stimulating hormone / ganirelix
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Tumors of pituitary gland or hypothalamus and abnormal uterine bleeding of undetermined origin
Side Effects	Ovarian enlargement presenting as abdominal or pelvic pain, tenderness, pressure, or swelling; nausea, vomiting, or diarrhea; shortness of breath; pain, warmth, or tenderness centralized in an arm or leg; fever or chills.
Useful Link	http://www.rxlist.com/menopur-drug.htm
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1217
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Follistim / Antagon (follicle stimulating hormone / ganirelix)
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Ovarian cyst or enlargement of undetermined origin, not due to polycystic ovary syndrome
Side Effects	Headache or drowsiness; weakness or aching of muscles or joints; breast enlargement or tenderness; pain, swelling, or irritation at the injection site; or rash.
Useful Link	http://www.drugs.com/mtm/menopur-injectable.html
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1218
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Repronex
Company	N.A.
Brand Discription	Repronex (menotropins for injection, USP) is a purified preparation of gonadotropins extracted from the urine of postmenopausal women. It is a combination of hormones which works by stimulating the ovaries to produce eggs
Prescribed for	Repronex is generally used as part of an assisted reproductive technology (ART) program to treat infertility in women.
Chemical Name	N.A.
Formulation	Each vial of Repronex (menotropins for injection) contains 75 International Units (IU) or 150 IU of follicle-stimulating hormone (FSH) activity and 75 IU or 150 IU of luteinizing hormone (LH) activity, respectively, plus 20 mg lactose monohydrate in a ste
Physcial Appearance	Sterile, lyophilized form
Route of Administration	Subcutaneous or intramuSubcutaneousular Injection.
Recommended Dosage	The initial dose of Repronex (menotropins for injection) for patients who have received GnRH agonist or antagonist pituitary suppression is 150 IU daily for the first 5 days of treatment. Based on clinical monitoring (including serum estradiol levels and
Contraindication	A high FSH level indicating primary ovarian failure.
Side Effects	Rash; hives; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); breast pain or enlarged breasts; calf, leg, or arm pain, swelling, redness, or tenderness; change in balance
Useful Link	http://www.drugs.com/cdi/repronex.html
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1219
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	An organic intracranial lesion such as a pituitary tumor.
Side Effects	Change in color of skin to a bluish color (eg, on the lips, nail beds, fingers, toes); changes in speech or vision; chest, jaw, or arm pain; confusion; coughing up blood; fainting; fast breathing; fast heartbeat.
Useful Link	http://www.drugs.com/drug-interactions/menotropins,repronex-index.html
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1220
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Ovarian cysts or enlargement not due to polycystic ovary syndrome.
Side Effects	Flu-like symptoms; one-sided weakness; pale skin; shortness of breath; sudden, severe nausea or vomiting; unusual sweating; weakness; yellowing of the skin or eyes.
Useful Link	http://www.rxlist.com/repronex-drug.htm
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1221
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Uncontrolled thyroid and adrenal dysfunction.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1222
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	The presence of any cause of infertility other than anovulation unless they are candidates for in vitro-fertilization.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1223
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Abnormal bleeding of undetermined origin.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1224
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Prior hypersensitivity to menotropins
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Primary information
ID	1225
ThPP ID	Th1029
Therapeutic Peptide/Protein Name	Menotropins
Sequence	Alpha-Chain(LH): APDVQDCPECTLQENPFFSQPGAPILQCMGCCF view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	23390.3
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	N.A.
Description	Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Repronex (menotropins for injection) is not indicated in women who are pregnant. There are limited human data on the effects of menotropins when administered during pregnancy.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	18020563
3-D Structure	Th1029 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb