Detailed description page of THPdb

This page displays user query in tabular form.

Th1021 details

Primary information
ID 1145
ThPP ID Th1021
Therapeutic Peptide/Protein Name Thyrotropin Alfa
Sequence Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional Classification IV
Molecular Weight 22672.9
Chemical Formula C975H1513N267O304S26
Isoelectric Point 7.5
Hydrophobicity -0.33
Melting Point (℃) 55
Half Life 5 Â± 10 hours
Description Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/Disease For detection of residueal or recurrent thyroid cancer
Pharmacodynamics Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of Action Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance Through kidney and liver
Categories Diagnostic Agents
Patents Number US5840566
Date of Issue 24/11/95
Date of Expiry 24/11/15
Drug Interaction N.A.
Target Thyrotropin receptor
Information of corresponding available drug in the market
Brand Name Thyrogen
Company Genzyme Inc
Brand Discription THYROGEN contains recombinant human thyroid stimulating hormone (TSH). Thyrotropin alfa is synthesized in a genetically modified Chinese hamster ovary cell line. Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subun
Prescribed for It is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc
Chemical Name N.A.
Formulation Each vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride.
Physcial Appearance Lyophilized powder
Route of Administration IntramuSubcutaneousular preferably the buttocks
Recommended Dosage A 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later.
Contraindication Allergic
Side Effects Rash; hives; itching; difficulty breathing; tightness in the chest
Useful Link http://www.rxlist.com/thyrogen-drug.htm
PubMed ID 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D Structure Th1021 (View) or (Download)

Primary information
ID 1146
ThPP ID Th1021
Therapeutic Peptide/Protein Name Thyrotropin Alfa
Sequence Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional Classification IV
Molecular Weight 22672.9
Chemical Formula C975H1513N267O304S26
Isoelectric Point 7.5
Hydrophobicity -0.33
Melting Point (℃) 55
Half Life 5 Â± 10 hours
Description Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/Disease For detection of residueal or recurrent thyroid cancer
Pharmacodynamics Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of Action Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance Through kidney and liver
Categories Diagnostic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Swelling of the mouth, face, lips, or tongue; confusion; one-sided weakness
Useful Link http://www.drugs.com/cdi/thyrogen.html
PubMed ID 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D Structure Th1021 (View) or (Download)

Primary information
ID 1147
ThPP ID Th1021
Therapeutic Peptide/Protein Name Thyrotropin Alfa
Sequence Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional Classification IV
Molecular Weight 22672.9
Chemical Formula C975H1513N267O304S26
Isoelectric Point 7.5
Hydrophobicity -0.33
Melting Point (℃) 55
Half Life 5 Â± 10 hours
Description Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/Disease For detection of residueal or recurrent thyroid cancer
Pharmacodynamics Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of Action Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance Through kidney and liver
Categories Diagnostic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Severe or persistent dizziness or headache; shortness of breath or other breathing problems; slurred speech; vision problems.
Useful Link http://www.drugs.com/drug-interactions/thyrotropin-alpha,thyrogen-index.html
PubMed ID 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D Structure Th1021 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

Primary information
ID	1145
ThPP ID	Th1021
Therapeutic Peptide/Protein Name	Thyrotropin Alfa
Sequence	Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional Classification	IV
Molecular Weight	22672.9
Chemical Formula	C975H1513N267O304S26
Isoelectric Point	7.5
Hydrophobicity	-0.33
Melting Point (℃)	55
Half Life	5 Â± 10 hours
Description	Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/Disease	For detection of residueal or recurrent thyroid cancer
Pharmacodynamics	Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of Action	Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	Through kidney and liver
Categories	Diagnostic Agents
Patents Number	US5840566
Date of Issue	24/11/95
Date of Expiry	24/11/15
Drug Interaction	N.A.
Target	Thyrotropin receptor
Information of corresponding available drug in the market
Brand Name	Thyrogen
Company	Genzyme Inc
Brand Discription	THYROGEN contains recombinant human thyroid stimulating hormone (TSH). Thyrotropin alfa is synthesized in a genetically modified Chinese hamster ovary cell line. Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subun
Prescribed for	It is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc
Chemical Name	N.A.
Formulation	Each vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride.
Physcial Appearance	Lyophilized powder
Route of Administration	IntramuSubcutaneousular preferably the buttocks
Recommended Dosage	A 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later.
Contraindication	Allergic
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest
Useful Link	http://www.rxlist.com/thyrogen-drug.htm
PubMed ID	23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D Structure	Th1021 (View) or (Download)

Primary information
ID	1146
ThPP ID	Th1021
Therapeutic Peptide/Protein Name	Thyrotropin Alfa
Sequence	Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional Classification	IV
Molecular Weight	22672.9
Chemical Formula	C975H1513N267O304S26
Isoelectric Point	7.5
Hydrophobicity	-0.33
Melting Point (℃)	55
Half Life	5 Â± 10 hours
Description	Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/Disease	For detection of residueal or recurrent thyroid cancer
Pharmacodynamics	Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of Action	Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	Through kidney and liver
Categories	Diagnostic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Swelling of the mouth, face, lips, or tongue; confusion; one-sided weakness
Useful Link	http://www.drugs.com/cdi/thyrogen.html
PubMed ID	23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D Structure	Th1021 (View) or (Download)

Primary information
ID	1147
ThPP ID	Th1021
Therapeutic Peptide/Protein Name	Thyrotropin Alfa
Sequence	Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional Classification	IV
Molecular Weight	22672.9
Chemical Formula	C975H1513N267O304S26
Isoelectric Point	7.5
Hydrophobicity	-0.33
Melting Point (℃)	55
Half Life	5 Â± 10 hours
Description	Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/Disease	For detection of residueal or recurrent thyroid cancer
Pharmacodynamics	Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of Action	Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	Through kidney and liver
Categories	Diagnostic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Severe or persistent dizziness or headache; shortness of breath or other breathing problems; slurred speech; vision problems.
Useful Link	http://www.drugs.com/drug-interactions/thyrotropin-alpha,thyrogen-index.html
PubMed ID	23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D Structure	Th1021 (View) or (Download)

Updated version of this database is available at ThpDB2

Detailed description page of THPdb