A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
Th1019 details |
Primary information | |
---|---|
ID | 1135 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | CA1341567 |
Date of Issue | 19/02/08 |
Date of Expiry | 19/02/25 |
Drug Interaction | Aminophylline. Interferon increases the effect and toxicity of theophylline |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Information of corresponding available drug in the market | |
Brand Name | PEG-Intron |
Company | Schering Corp |
Brand Discription | PegIntron is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol. The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PegIntron molecule is approxim |
Prescribed for | Used to treat chronic hepatitis C in adults. Peginterferon alfa-2b is often used in combination with another medication called ribavirin (Rebetol, Ribasphere) to treat hepatitis C in adults and children who are at least 3 years old. It may be used in comb |
Chemical Name | N.A. |
Formulation | Provided in both vials and the REDIPEN. Each vial contains either 74 mcg, 118.4 mcg, 177.6 mcg, or 222 mcg of PegIntron as a white to off-white tablet-like solid that is whole/in pieces or as a loose powder, and 1.11 mg dibasic sodium phosphate anhydrous, |
Physcial Appearance | Powder |
Route of Administration | Subcutaneous Injection |
Recommended Dosage | 1.5 mcg/kg/week. The volume of PegIntron to be injected depends on the strength of PegIntron and patient's body weight |
Contraindication | Allergic or in case of having autoimmune hepatitis, liver failure, severe kidney disease, a hemoglobin blood cell disorder |
Side Effects | Vision problems; fast heart rate, feeling like you might pass out; unusual weakness; high fever with severe stomach pain and bloody diarrhea; pain or burning when you urinate; severe pain in your upper stomach spreading to your back, nausea and vomiting and new or worsening liver symptoms. |
Useful Link | http://www.drugs.com/peg-intron.html |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |
Primary information | |
---|---|
ID | 1136 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | CA2329474 |
Date of Issue | 0002-02-26 |
Date of Expiry | 31/10/16 |
Drug Interaction | Dyphylline.Interferon increases the effect and toxicity of theophylline |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | Headache, joint or muscle pain; nausea, dry mouth, loss of appetite, weight loss; dizziness, sleep problems (insomnia), feeling mildly anxious, depressed, or irritable; or pain, redness, swelling, or irritation where the medicine was injected. |
Useful Link | http://www.rxlist.com/peg-intron-drug.htm |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |
Primary information | |
---|---|
ID | 1137 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | Oxtriphylline. Interferon increases the effect and toxicity of theophylline |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | N.A. |
Useful Link | N.A. |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |
Primary information | |
---|---|
ID | 1138 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | Theophylline. Interferon increases the effect and toxicity of theophylline |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | N.A. |
Useful Link | N.A. |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |
Primary information | |
---|---|
ID | 1139 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | Aldesleukin |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | Unitron PEG |
Company | N.A. |
Brand Discription | Unitron Peg belongs to the group of medications known as interferons. |
Prescribed for | It is used to treat chronic hepatitis C (a disease of the liver) for people who cannot tolerate or use the antiviral medication, ribavirin. The most effective treatment of chronic hepatitis C is the combination of an interferon and ribavirin. Unitron Peg |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | Lyophilized powder |
Route of Administration | Subcutaneous Injection |
Recommended Dosage | Its Subcutaneous injection once a week on the same day of the week for 48 weeks. Dosing is based on body weight. Treatment with this medication should be stopped if no response is noticed after 6 months. |
Contraindication | Allergic |
Side Effects | Abdominal pain or swelling, anemia (paleness, tiredness, shortness of breath), changes in mood (e.g., irritability, depression, anxiety, aggression), confusion, dizziness, eye pain or swelling of the eye, high blood sugar (increased thirst, hunger, weakness, irritability, trouble concentrating, signs of infection (e.g., chills, fever, cough, sore throat, difficulty or painful urination, difficulty breathing), burning sensation in arms or legs, ulcers in mouth or sore throats. |
Useful Link | http://chealth.canoe.ca/drug_info_details.asp?brand_name_id=1812 |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |
Primary information | |
---|---|
ID | 1140 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | Telbivudine |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | Person having decompensated liver disease, epilepsy (seizures), autoimmune diseases (including autoimmune hepatitis), severe psychiatric conditions, severely reduced kidney function and thyroid disease, when medication cannot bring thyroid function in |
Side Effects | Signs of infection (e.g., chills, fever, cough, sore throat, difficulty or painful urination, difficulty breathing), tingling or burning sensation in arms or legs, ulcers or sores in the mouth or throat, unusual bruising or bleeding (e.g., bleeding gums, |
Useful Link | http://www.medicatione.com/?c=drug&s=unitron%20peg |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |
Primary information | |
---|---|
ID | 1141 |
ThPP ID | Th1019 |
Therapeutic Peptide/Protein Name | Peginterferon alfa-2b |
Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 31000 |
Chemical Formula | C130H219N43O42 |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | Approximately 40 hours (range 22 to 60 hours) in patients with HCV infection |
Description | Peginterferon alfa-2b is a covalent conjugate of recombinant alfa-2b interferon with monomethoxy polyethylene glycol (PEG). The average molecular weight of the PEG portion of the molecule is 12,000 daltons. The average molecular weight of the PEG-Intron molecule is approximately 31,000 daltons. The specific activity of peginterferon alfa-2b is approximately 0.7 x 108 IU/mg protein. Interferon alfa-2b is a water-soluble protein with a molecular weight of 19,271 daltons produced by recombinant DNA techniques. It is obtained from the bacterial fermentation of a strain of Escherichia coli bearing a genetically engineered plasmid containing an interferon gene from human leukocytes. The PEG strand protects the molecule in vivo from proteolytic breakdown, substantially increases its in vivo half-life, and reduces immunogenicity by wrapping around and physically hindering access to the protein portion of the molecule. |
Indication/Disease | Used for the treatment of chronic hepatitis C in patients not previously treated with interferon alpha who have compensated liver disease and are at least 18 years of age. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2-5 oligoadenylate synthetase (2-5 A synthetase) and protein kinase R. |
Mechanism of Action | It binds to type I interferon receptors IFNAR1 and IFNAR2c which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | After a single subcutaneous dose of peginterferon alfa-2b, the mean absorption half-life was 4.6 hours. |
Volume of Distribution | N.A. |
Clearance | Oral cl=22 mL/hr/kg [patients with HCV infection], Renal elimination accounts for 30% of the clearance. |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | Theophylline |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | Decreased desire for sexual activities, drowsiness, dry mouth, dry skin, flu-like symptoms (unusual tiredness, fever, chills, muscle aches, joint pain and headaches), flushing of the skin, indigestion, loss of appetite, nausea, pain in bones, joints, or muscle stiffness. |
Useful Link | http://www.igenericdrugs.com/?s=unitron%20peg |
PubMed ID | 26280154, 26261238, 25771464, 25117425, 25068004, 24974131, 24119723, 24059964, 23746377 |
3-D Structure | Th1019 (View) or (Download) |